ATP5MF (NM_001039178) Human Tagged ORF Clone
CAT#: RC223040
- TrueORF®
ATP5J2 (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 (ATP5J2), nuclear gene encoding mitochondrial protein, transcript variant 4
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_001039178" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | ATP5MF |
Synonyms | ATP5J2; ATP5JL |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC223040 representing NM_001039178
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGTCAGTTGTACCAGTGAAGGACAAGAAACTTCTGGAGGTCAAACTGGGGGAGCTGCCAAGCTGGA TCTTGATGCGGGACTTCAGTCCTAGTGGCATTTTCGGAGCGTTTCAAAGAGAGCACGAGCGGCTCCGCAA ATACCAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC223040 representing NM_001039178
Red=Cloning site Green=Tags(s) MASVVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQREHERLRKYH myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001039178 |
ORF Size | 147 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001039178.3 |
RefSeq Size | 393 bp |
RefSeq ORF | 150 bp |
Locus ID | 9551 |
UniProt ID | P56134 |
Cytogenetics | 7q22.1 |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, Oxidative phosphorylation |
MW | 5.7 kDa |
Gene Summary | Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The catalytic portion of mitochondrial ATP synthase consists of five different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The proton channel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the f subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This gene has multiple pseudogenes. Naturally occurring read-through transcription also exists between this gene and the downstream pentatricopeptide repeat domain 1 (PTCD1) gene. [provided by RefSeq, Nov 2010] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC223040L3 | Lenti-ORF clone of ATP5J2 (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 (ATP5J2), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 465.00 |
|
RC223040L4 | Lenti-ORF clone of ATP5J2 (mGFP-tagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 (ATP5J2), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 465.00 |
|
RG223040 | ATP5J2 (tGFP-tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 (ATP5J2), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 365.00 |
|
SC310856 | ATP5J2 (untagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 (ATP5J2), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 165.00 |
{0} Product Review(s)
Be the first one to submit a review