DRP1 (DNM1L) (NM_012062) Human Tagged ORF Clone

CAT#: RC221708

Reviews ()
Write a review

DNM1L (Myc-DDK-tagged)-Human dynamin 1-like (DNM1L), transcript variant 1



Reconstitution Protocol

USD 674.00

In Stock*

Size
    • 10 ug

Product images

Other products for "DNM1L"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DNM1L
Synonyms DLP1; DRP1; DVLP; DYMPLE; EMPF; EMPF1; HDYNIV; OPA5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221708 representing NM_012062
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGCTAATTCCTGTCATAAACAAGCTCCAGGACGTCTTCAACACGGTGGGCGCCGACATCATCC
AGCTGCCTCAAATCGTCGTAGTGGGAACGCAGAGCAGCGGAAAGAGCTCAGTGCTAGAAAGCCTGGTGGG
GAGGGACCTGCTTCCCAGAGGTACTGGAATTGTCACCCGGAGACCTCTCATTCTGCAACTGGTCCATGTT
TCACAAGAAGATAAACGGAAAACAACAGGAGAAGAAAATGGGGTGGAAGCAGAAGAATGGGGTAAATTTC
TTCACACCAAAAATAAGCTTTACACGGATTTTGATGAAATTCGACAAGAAATTGAAAATGAAACAGAAAG
AATTTCAGGAAATAATAAGGGAGTAAGCCCTGAACCAATTCATCTTAAGATTTTTTCACCCAACGTTGTC
AATTTGACACTTGTGGATTTGCCAGGAATGACCAAGGTGCCTGTAGGTGATCAACCTAAGGATATTGAGC
TTCAAATCAGAGAGCTCATTCTTCGGTTCATCAGTAATCCTAATTCCATTATCCTCGCTGTCACTGCTGC
TAATACAGATATGGCAACATCAGAGGCACTTAAAATTTCAAGAGAGGTAGATCCAGATGGTCGCAGAACC
CTAGCTGTAATCACTAAACTTGATCTCATGGATGCGGGTACTGATGCCATGGATGTATTGATGGGAAGGG
TTATTCCAGTCAAACTTGGAATAATTGGAGTAGTTAACAGGAGCCAGCTAGATATTAACAACAAGAAGAG
TGTAACTGATTCAATCCGTGATGAGTATGCTTTTCTTCAAAAGAAATATCCATCTCTGGCCAATAGAAAT
GGAACAAAGTATCTTGCTAGGACTCTAAACAGGTTACTGATGCATCACATCAGAGATTGTTTACCAGAGT
TGAAAACAAGAATAAATGTTCTAGCTGCTCAGTATCAGTCTCTTCTAAATAGCTACGGTGAACCCGTGGA
TGATAAAAGTGCTACTTTACTCCAACTTATTACCAAATTTGCCACAGAATATTGTAACACTATTGAAGGA
ACTGCAAAATATATTGAAACTTCGGAGCTATGCGGTGGTGCTAGAATTTGTTATATTTTCCATGAGACTT
TTGGGCGAACCTTAGAATCTGTTGATCCACTTGGTGGCCTTAACACTATTGACATTTTGACTGCCATTAG
AAATGCTACTGGTCCTCGTCCTGCTTTATTTGTGCCTGAGGTTTCATTTGAGTTACTGGTGAAGCGGCAA
ATCAAACGTCTAGAAGAGCCCAGCCTCCGCTGTGTGGAACTGGTTCATGAGGAAATGCAAAGGATCATTC
AGCACTGTAGCAATTACAGTACACAGGAATTGTTACGATTTCCTAAACTTCATGATGCCATAGTTGAAGT
GGTGACTTGTCTTCTTCGTAAAAGGTTGCCTGTTACAAATGAAATGGTCCATAACTTAGTGGCAATTGAA
CTGGCTTATATCAACACAAAACATCCAGACTTTGCTGATGCTTGTGGGCTAATGAACAATAATATAGAGG
AACAAAGGAGAAACAGGCTAGCCAGAGAATTACCTTCAGCTGTATCACGAGACAAGTCTTCTAAAGTTCC
AAGTGCTTTGGCACCTGCCTCCCAGGAGCCCTCCCCCGCTGCTTCTGCTGAGGCTGATGGCAAGTTAATT
CAGGACAGCAGAAGAGAAACTAAAAATGTTGCATCTGGAGGTGGTGGGGTTGGAGATGGTGTTCAAGAAC
CAACCACAGGCAACTGGAGAGGAATGCTGAAAACTTCAAAAGCTGAAGAGTTATTAGCAGAAGAAAAATC
AAAACCCATTCCAATTATGCCAGCCAGTCCACAAAAAGGTCATGCCGTGAACCTGCTAGATGTGCCAGTT
CCTGTTGCACGAAAACTATCTGCTCGGGAACAGCGAGATTGTGAGGTTATTGAACGACTCATTAAATCAT
ATTTTCTCATTGTCAGAAAGAATATTCAAGACAGTGTGCCAAAGGCAGTAATGCATTTTTTGGTTAATCA
TGTGAAAGACACTCTTCAGAGTGAGCTAGTAGGCCAGCTGTATAAATCATCCTTATTGGATGATCTTCTG
ACAGAATCTGAGGACATGGCACAGCGCAGGAAAGAAGCAGCTGATATGCTAAAGGCATTACAAGGAGCCA
GTCAAATTATTGCTGAAATCCGGGAGACTCATCTTTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221708 representing NM_012062
Red=Cloning site Green=Tags(s)

MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHV
SQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVV
NLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRT
LAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRN
GTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEG
TAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIE
LAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLI
QDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPV
PVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLL
TESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012062
ORF Size 2208 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012062.5
RefSeq Size 3293 bp
RefSeq ORF 2211 bp
Locus ID 10059
UniProt ID O00429
Cytogenetics 12p11.21
Protein Pathways Endocytosis, Fc gamma R-mediated phagocytosis
MW 81.7 kDa
Gene Summary This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated in several neurological disorders, including Alzheimer's disease. Mutations in this gene are associated with the autosomal dominant disorder, encephalopathy, lethal, due to defective mitochondrial and peroxisomal fission (EMPF). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.