GDNF (NM_199234) Human Tagged ORF Clone
CAT#: RC221484
GDNF (Myc-DDK-tagged)-Human glial cell derived neurotrophic factor (GDNF), transcript variant 3
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_199234" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | GDNF |
Synonyms | astrocyte-derived trophic factor; ATF1; ATF2; glial cell derived neurotrophic factor; glial cell line derived neurotrophic factor; glial derived neurotrophic factor; HFB1-GDNF |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC221484 representing NM_199234
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGATGTCGTGGCTGTCTGCCTGGTGCTGCTCCACACCGCGTCCGCCTTCCCGCTGCCAACCCAGAGA ATTCCAGAGGAAAAGGTCGGAGAGGCCAGAGGGGCAAAAACCGGGGTTGTGTCTTAACTGCAATACATTT AAATGTCACTGACTTGGGTCTGGGCTATGAAACCAAGGAGGAACTGATTTTTAGGTACTGCAGCGGCTCT TGCGATGCAGCTGAGACAACGTACGACAAAATATTGAAAAACTTATCCAGAAATAGAAGGCTGGTGAGTG ACAAAGTAGGGCAGGCATGTTGCAGACCCATCGCCTTTGATGATGACCTGTCGTTTTTAGATGATAACCT GGTTTACCATATTCTAAGAAAGCATTCCGCTAAAAGGTGTGGATGTATC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC221484 representing NM_199234
Red=Cloning site Green=Tags(s) MGCRGCLPGAAPHRVRLPAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGS CDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_199234 |
ORF Size | 399 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_199234.1, NP_954704.1 |
RefSeq Size | 410 bp |
RefSeq ORF | 401 bp |
Locus ID | 2668 |
Cytogenetics | 5p13.2 |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
MW | 14.6 kDa |
Gene Summary | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The recombinant form of this protein, a highly conserved neurotrophic factor, was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Mutations in this gene may be associated with Hirschsprung disease and Tourette syndrome. This gene encodes multiple protein isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC221484L1 | Lenti ORF clone of Human glial cell derived neurotrophic factor (GDNF), transcript variant 3, Myc-DDK-tagged |
USD 450.00 |
|
RC221484L2 | Lenti ORF clone of Human glial cell derived neurotrophic factor (GDNF), transcript variant 3, mGFP tagged |
USD 450.00 |
|
RC221484L3 | Lenti ORF clone of Human glial cell derived neurotrophic factor (GDNF), transcript variant 3, Myc-DDK-tagged |
USD 450.00 |
|
RC221484L4 | Lenti ORF clone of Human glial cell derived neurotrophic factor (GDNF), transcript variant 3, mGFP tagged |
USD 450.00 |
|
RG221484 | GDNF (tGFP-tagged) - Human glial cell derived neurotrophic factor (GDNF), transcript variant 3 |
USD 350.00 |
|
SC307906 | GDNF (untagged)-Human glial cell derived neurotrophic factor (GDNF), transcript variant 3 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review