FER1L6 (NM_001039112) Human Tagged ORF Clone

CAT#: RC221305

FER1L6 (Myc-DDK-tagged)-Human fer-1-like 6 (C. elegans) (FER1L6)

Clone Modification / Custom Cloning Service

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FER1L6 (NM_001039112) Human Tagged ORF Clone
Symbol FER1L6
Synonyms C8ORFK23
Vector pCMV6-Entry
Sequence Data
>RC221305 representing NM_001039112
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGGGCTGAAGGTGAAGAAGAAGAGAAATAAGGCAGAGAAGGGGTTAATCCTAGCCAACAAGGCTG
CGAAAGATAGTCAAGGTGACACTGAAGCACTGCAGGAGGAGCCTTCTCACCAGGAAGGACCGAGAGGAGA
TTTGGTCCATGATGATGCTTCTATCTTTCCTGTCCCCTCAGCTTCTCCAAAGAGAAGATCAAAACTATTG
ACTAAGATCCATGATGGGGAGGTCAGATCCCAAAATTATCAAATTGCCATAACCATCACCGAGGCTCGCC
AGCTGGTGGGTGAGAACATTGACCCAGTTGTGACCATTGAGATTGGGGATGAGAAGAAGCAAAGCACAGT
GAAGGAAGGAACCAACAGCCCATTTTATAATGAATACTTTGTCTTCGACTTCATTGGGCCCCAAGTGCAT
CTTTTTGACAAGATCATCAAAATCTCCGTCTTTCACCACAAGCTGATAGGAAGTGTACTGATTGGCTCTT
TCAAAGTAGACCTGGGGACCGTGTACAACCAACCTGGTCATCAGTTCTGCAACAAGTGGGCCCTGCTCAC
AGACCCTGGTGACATCAGGACTGGCACCAAGGGGTACCTGAAATGTGACATCAGTGTCATGGGAAAAGGT
GATGTCTTGAAGACCAGCCCTAAAACTTCTGACACCGAGGAGCCAATAGAAAAGAACCTTTTGATCCCCA
ATGGGTTTCCACTGGAGAGACCGTGGGCCAGATTCTATGTGAGACTCTACAAAGCAGAAGGGTTGCCCAA
AATGAATTCAAGCATCATGGCGAACGTCACCAAGGCATTTGTGGGTGACAGTAAGGACCTGGTGGATCCC
TTTGTGGAGGTCTCCTTTGCTGGGCAGATGGGGCGAACCACAGTGCAGAAGAACTGTGCTGATCCTGTGT
GGCATGAACAGGTGATCTTCAAGGAAATGTTCCCTCCCTTGTGTCGGAGGGTGAAAATCCAGGTGTGGGA
TGAAGGCAGCATGAATGACGTAGCCCTGGCAACCCATTTCATTGACCTGAAGAAAATCTCCAACGAACAG
GATGGAGACAAAGGCTTTCTGCCCACCTTTGGGCCTGCCTGGATTAACCTGTATGGCTCGCCCAGGAACC
ACAGTCTGATGGATGACTACCAGGAAATGAACGAAGGCTTTGGGGAAGGTGTGTCATTCAGGGGCAGAAT
CTTGGTAGAAATTGCTGTGGAAATCCTCTCAGGACGGGCACAGGAATCTAAATTTTCCAAGGCCCTGAAG
GAGCTCAAGTTGCCTTCCAAGGACAAAGACTCCAAATCTTCCAAAGGTAAAGACAAGGCTGACAAAACTG
AAGATGGAAAATCCCAACAGGCTTCAAACAAAACTAACTCAACCGAGGTGGAGGTGGAATCGTTCGATGT
CCCCCCGGAGATTGTACCAGAAAAAAATGAGGAATTTTTACTCTTTGGAGCATTTTTTGAAGCTACCATG
ATTGACCGGAAGATTGGAGATAAACCCATCAGCTTTGAAGTTTCTATTGGTAATTTTGGAAACCTGATTG
ATGGAGGATCCCATTATGGGAGTAAGAAGTCAGCTGAATCAGCTGAAGAAGACCTCCTTCCACTGCTTCA
CGAAGGGCAAGGGGATGTGGCCCATGATGTTCCCATTCCTATGGCCTCCACCACTCACCCGGAGAAGCCA
CTGGTGACAGAAGGGAACAGGAATTACAACTATTTGCCATTTGAGGCTAAGAAGCCCTGTGTCTATTTCA
TCAGCTCTTGGGGAGACCAGACCTTCAGGCTGCACTGGTCCAACATGCTGGAGAAAATGGCAGACTTCCT
GGAAGAAAGTATAGAAGAAGTGAGAGAATTGATCAAGATTTCACAGGAGGCACCTGAAGAGAAAATGAAA
ACAGTGCTCAGTGACTTCATCAGTCGGAGCAGTGCCTTTATCTCTGAAGCAGAAAAAAAGCCCAAGATGT
TGAACCAAACCACTTTAGATAAGAAGCGACTTACGCTCTGCTGGCAGGAGCTGGAAGCAATGTGCAAGGA
GGCCAAGGGGATCATTCAGCAGCAGAAGAAAAAGTTATCTGTTGATGAAATGATTCACGAAGCCCAAAAC
TTTGTGGAAAAAATCCGCTTTCTTGTTGATGAGCCCCAGCACACTATCCCTGACGTTTTCATCTGGATGC
TCAGCAACAACAGGAGAGTGGCCTATGCCCGCATCGCCTCCAAAGACCTCCTCTATTCCCCTGTCGCGGG
GCAGATGGGCAAACACTGCGGCAAGATCAAAACTCACTTCCTCAAACCTCCTGGGAAACGACCGGCTGGT
TGGTCTGTGCAAGCAAAAGTCGACGTGTACCTGTGGCTGGGCTCCATCAAGCATGCCAGTGCCATTTTGG
ACAACTTGCCAGTAGGCTATGAAGCAGAAATGTCCTCCAAAGGGGCTGGCACCAATCACCCCCCATCTAA
CCTGCTCTACCAAGAACAGCATGTTTTTCAGCTGAGGGCTCACATGTACCAAGCCCGGGGCCTCATCGCA
GCTGACAGCAATGGACTTTCAGACCCTTTTGCCAAAGTCACGTTCCTTTCTCACTGCCAGACAACAAAGA
TAATCTCCCAGACCCTCTCTCCGACCTGGAACCAGATGCTGCTGTTCAATGATTTGGTGCTGCATGGAGA
TGTGAAGGAGCTGGCAGAGTCCCCGCCCTTAGTGGTGGTGGAGCTGTATGACAGCGACGCTGTGGGGAAG
CCAGAATATTTGGGTGCCACAGTGGCTGCTCCTGTTGTGAAGCTGGCTGACCAGGACTATGAGCCCCCCA
GGTTATGCTATCACCCCATCTTTTGTGGGAATCTCTCTGGAGGGGATCTCCTTGCTGTATTTGAACTGCT
GCAGGTTCCTCCTTCTGGGCTGCAAGGCCTCCCACCCGTTGAGCCACCAGACATCACCCAGATCTACCCG
GTTCCTGCCAACATTCGGCCGGTGCTGAGCAAATACCGAGTGGAGGTTCTCTTCTGGGGAGTTCGGGAAA
TGAAGAAGGTGCAGCTCCTCTCTGTGGATCGGCCTCAGGCTCTCATTGAGTGCGGAGGACAAGGTGTGAA
GTCCTGCGTGATCCAGAGCTACAAGAACAACCCGAACTTCAGCATCCAGGCAGACGCTTTCGAAGTGGAA
CTGCCTGAGAACGAGCTTCTGCACCCGCCACTGAGCATCTGCGTGGTGGACTGGAGAGCTTTTGGGAGGA
GTACCCTTGTGGGCACCTACACCATCAACTACTTGAAGCAGTTTTTGTGTAAACTCAGAGAGCCCCTTGC
CCCCATCACACAGGTGGATGGAACCCAGCCTGGGCACGATATTTCAGATTCGCTAACAGCCACTGAGTCC
TCTGGAGCCCACAGCTCCTCCCAGGATCCCCCAGCAGATCACATTTATGTGGATGTTGAGCCACCTCCCA
CAGTGGTGCCCGACTCTGCCCAGGCCCAGCCGGCCATCCTGGTTGACGTCCCTGACTCATCCCCGATGCT
GGAGCCTGAACACACACCTGTAGCCCAGGAGCCACCAAAAGATGGAAAACCTAAGGATCCCAGGAAGCCT
TCCCGGAGGTCCACTAAGAGGAGAAAGAGGACCATAGCAGATGAATCTGCTGAAAACGTGATTGACTGGT
GGTCTAAGTATTATGCCTCCCTGAAGAAAGCCCAGAAGGCAAAGGAGAGAAATCCCAAGGGAAAAAAAGG
CAATACAGAGGCAAAGCCAGATGAGGTAGTGGTAGATATAGAAGATGGGCCAAAGAAGAAGAAAGACAAA
ATGCTCAAGAAGAAACCCAAAGATGATGGAATCCCCAACCTGGCCATCTTGCAGATATATGACGGTGATC
TCGAGAGTGAATTCAACAATTTTGAAGACTGGGTGAAAACTTTTGAGCTCTTCAGAGGCAAGTCTACGGA
AGATGACCATGGTCTTGATGGAGACCNAGTCATAGGAAAATTTAAGGGCTCCTTCTGCATCTACAAAAGC
CCCCAGGATTCTAGCTCTGAGGACAGCGGGCAGCTGAGAATCCAGCAAGGGATTCCGCCCAATCACCCTG
TCACAGTGCTGATCAGAGTATACATTGTCGCGGCATTTAATCTTAGTCCAGCTGATCCAGATGGCAAATC
AGATCCCTACATTGTGATCAAGCTTGGCAAGACAGAAATCAAAGACCGGGATAAATACATCCCTAAACAA
CTGAACCCAGTATTTGGAAGGTCATTTGAGATCCAAGCCACATTCCCAAAAGAGTCCCTGCTCTCCATCC
TGATCTATGACCATGACATGATTGGCACAGATGACCTTATTGGTGAGACCAAGATCGACCTGGAGAACCG
CTTCTACAGCAAACACCGAGCCATCTGTGGCTTGCAGAGCCAGTATGAGATAGAAGGATACAATGCCTGG
AGAGACACGTCCAAACCCACCGAAATCCTCACTAAGCTCTGCAAAGACAACAAGCTGGATGGACCCTACT
TTCACCCTGGGAAAATACAGATAGGAAACCAAGTCTTTTCTGGAAAAACTATCTTCACTGAAGAGGACAC
TGATGAGACAGTGGAGTCTTATGAACACCTGGCCCTCAAGGTTTTACACTCTTGGGAGGATATCCCAGAA
GTTGGGTGTAGGCTGGTTCCTGAACACATAGAAACTCGGCCACTGTACCACAAGGATAAGCCAGGAATGG
AGCAGGGCCGCCTGCAGATGTGGGTGGACATGTTTCCCAAGGATATGCCTCAACCTGGACCTCCTGTTGA
CATCTCTCCAAGGCGACCCAAAGGATACGAATTGAGAGTGACCATCTGGAACACTGAAGATGTCATTTTA
GAGGATGAGAATATCTTCACAGGCCAAAAATCAAGTGATATTTATGTGAAAGGGTGGTTAAAGGGCTTGG
AGGATGACAAGCAGGAGACAGATGTGCATTACAACTCCCTGACTGGAGAGGGCAACTTCAACTGGCGCTT
CCTGTTTCCCTTTCAGTATCTCCCAGCTGAGAAGCAAATGGTCATTACCAAGAGGGAGAACATCTTCTCT
TTAGAGAAGATGGAGTGTAAGACTCCTGCTGTGTTGGTGCTGCAGGTTTGGGATTTTGAAAGGCTGTCCT
CAGATGACTTCCTGGGCACCCTGGAAATGAACCTCAACAGTTTCCCTCGAGCAGCTAAGTCTGCCAAAGC
CTGTGATCTTGCCAAGTTTGAAAATGCAAGTGAGGAGACCAAGATCTCTATATTCCAGCAAAAACGTGTG
CGTGGCTGGTGGCCTTTTTCTAAAAGCAAAGAACTCACAGGCAAGGTTGAAGCTGAGTTCCACCTAGTTA
CAGCAGAAGAAGCTGAGAAAAATCCTGTTGGAAAAGCCCGAAAGGAGCCAGAGCCCCTGGCCAAGCCCAA
CCGCCCAGACACCTCCTTTTCGTGGTTCATGAGCCCCTTTAAGTGCCTGTACTACCTCATCTGGAAGAAT
TACAAAAAGTACATCATCATTGCTTTCATTCTCATCATCCTCATCATCTTCCTCGTCCTTTTCATCTACA
CCTTGCCAGGAGCCATCAGCCGAAGGATCGTTGTGGGCTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221305 representing NM_001039112
Red=Cloning site Green=Tags(s)

MFGLKVKKKRNKAEKGLILANKAAKDSQGDTEALQEEPSHQEGPRGDLVHDDASIFPVPSASPKRRSKLL
TKIHDGEVRSQNYQIAITITEARQLVGENIDPVVTIEIGDEKKQSTVKEGTNSPFYNEYFVFDFIGPQVH
LFDKIIKISVFHHKLIGSVLIGSFKVDLGTVYNQPGHQFCNKWALLTDPGDIRTGTKGYLKCDISVMGKG
DVLKTSPKTSDTEEPIEKNLLIPNGFPLERPWARFYVRLYKAEGLPKMNSSIMANVTKAFVGDSKDLVDP
FVEVSFAGQMGRTTVQKNCADPVWHEQVIFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQ
DGDKGFLPTFGPAWINLYGSPRNHSLMDDYQEMNEGFGEGVSFRGRILVEIAVEILSGRAQESKFSKALK
ELKLPSKDKDSKSSKGKDKADKTEDGKSQQASNKTNSTEVEVESFDVPPEIVPEKNEEFLLFGAFFEATM
IDRKIGDKPISFEVSIGNFGNLIDGGSHYGSKKSAESAEEDLLPLLHEGQGDVAHDVPIPMASTTHPEKP
LVTEGNRNYNYLPFEAKKPCVYFISSWGDQTFRLHWSNMLEKMADFLEESIEEVRELIKISQEAPEEKMK
TVLSDFISRSSAFISEAEKKPKMLNQTTLDKKRLTLCWQELEAMCKEAKGIIQQQKKKLSVDEMIHEAQN
FVEKIRFLVDEPQHTIPDVFIWMLSNNRRVAYARIASKDLLYSPVAGQMGKHCGKIKTHFLKPPGKRPAG
WSVQAKVDVYLWLGSIKHASAILDNLPVGYEAEMSSKGAGTNHPPSNLLYQEQHVFQLRAHMYQARGLIA
ADSNGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNDLVLHGDVKELAESPPLVVVELYDSDAVGK
PEYLGATVAAPVVKLADQDYEPPRLCYHPIFCGNLSGGDLLAVFELLQVPPSGLQGLPPVEPPDITQIYP
VPANIRPVLSKYRVEVLFWGVREMKKVQLLSVDRPQALIECGGQGVKSCVIQSYKNNPNFSIQADAFEVE
LPENELLHPPLSICVVDWRAFGRSTLVGTYTINYLKQFLCKLREPLAPITQVDGTQPGHDISDSLTATES
SGAHSSSQDPPADHIYVDVEPPPTVVPDSAQAQPAILVDVPDSSPMLEPEHTPVAQEPPKDGKPKDPRKP
SRRSTKRRKRTIADESAENVIDWWSKYYASLKKAQKAKERNPKGKKGNTEAKPDEVVVDIEDGPKKKKDK
MLKKKPKDDGIPNLAILQIYDGDLESEFNNFEDWVKTFELFRGKSTEDDHGLDGDXVIGKFKGSFCIYKS
PQDSSSEDSGQLRIQQGIPPNHPVTVLIRVYIVAAFNLSPADPDGKSDPYIVIKLGKTEIKDRDKYIPKQ
LNPVFGRSFEIQATFPKESLLSILIYDHDMIGTDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAW
RDTSKPTEILTKLCKDNKLDGPYFHPGKIQIGNQVFSGKTIFTEEDTDETVESYEHLALKVLHSWEDIPE
VGCRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDMPQPGPPVDISPRRPKGYELRVTIWNTEDVIL
EDENIFTGQKSSDIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVITKRENIFS
LEKMECKTPAVLVLQVWDFERLSSDDFLGTLEMNLNSFPRAAKSAKACDLAKFENASEETKISIFQQKRV
RGWWPFSKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMSPFKCLYYLIWKN
YKKYIIIAFILIILIIFLVLFIYTLPGAISRRIVVGS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001039112
ORF Size 5571 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001039112.1, NM_001039112.2, NP_001034201
RefSeq Size 6058
RefSeq ORF 5574
Locus ID 654463
Cytogenetics 8q24.13
Protein Families Transmembrane
MW 209.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)