DKK4 (NM_014420) Human Tagged ORF Clone

CAT#: RC221217

DKK4 (Myc-DDK-tagged)-Human dickkopf homolog 4 (Xenopus laevis) (DKK4)

Clone Modification / Custom Cloning Service

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DKK4 (NM_014420) Human Tagged ORF Clone
Symbol DKK4
Synonyms DKK-4
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC221217 representing NM_014420
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGCGGCCGTCCTGCTGGGGCTGAGCTGGCTCTGCTCTCCCCTGGGAGCTCTGGTCCTGGACTTCA
ACAACATCAGGAGCTCTGCTGACCTGCATGGGGCCCGGAAGGGCTCACAGTGCCTGTCTGACACGGACTG
CAATACCAGAAAGTTCTGCCTCCAGCCCCGCGATGAGAAGCCGTTCTGTGCTACATGTCGTGGGTTGCGG
AGGAGGTGCCAGCGAGATGCCATGTGCTGCCCTGGGACACTCTGTGTGAACGATGTTTGTACTACGATGG
AAGATGCAACCCCAATATTAGAAAGGCAGCTTGATGAGCAAGATGGCACACATGCAGAAGGAACAACTGG
GCACCCAGTCCAGGAAAACCAACCCAAAAGGAAGCCAAGTATTAAGAAATCACAAGGCAGGAAGGGACAA
GAGGGAGAAAGTTGTCTGAGAACTTTTGACTGTGGCCCTGGACTTTGCTGTGCTCGTCATTTTTGGACGA
AAATTTGTAAGCCAGTCCTTTTGGAGGGACAGGTCTGCTCCAGAAGAGGGCATAAAGACACTGCTCAAGC
TCCAGAAATCTTCCAGCGTTGCGACTGTGGCCCTGGACTACTGTGTCGAAGCCAATTGACCAGCAATCGG
CAGCATGCTCGATTAAGAGTATGCCAAAAAATAGAAAAGCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221217 representing NM_014420
Red=Cloning site Green=Tags(s)

MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLR
RRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQ
EGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNR
QHARLRVCQKIEKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014420
ORF Size 672 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014420.1, NM_014420.2, NP_055235
RefSeq Size 835
RefSeq ORF 675
Locus ID 27121
Cytogenetics 8p11.21
Protein Families Stem cell relevant signaling - Wnt Signaling pathway, Secreted Protein, ES Cell Differentiation/IPS, Adult stem cells, Cancer stem cells, Druggable Genome
Protein Pathways Wnt signaling pathway
MW 24.88 kDa
Gene Summary This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. Activity of this protein is modulated by binding to the Wnt co-receptor and the co-factor kremen 2. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)