BTG3 (NM_006806) Human Tagged ORF Clone

CAT#: RC221056

Reviews ()
Write a review

BTG3 (Myc-DDK-tagged)-Human BTG family, member 3 (BTG3), transcript variant 2



  "NM_006806" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BTG3 (NM_006806) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BTG3
Synonyms ANA; ANA/BTG3; APRO4; TOB5; TOB55; TOFA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC221056 representing NM_006806
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGAATGAAATTGCTGCCGTTGTCTTCTTTTTCACAAGGCTAGTTCGAAAACATGATAAGTTGAAAA
AAGAGGCAGTTGAGAGGTTTGCTGAGAAATTGACCCTAATACTTCAAGAAAAATATAAAAATCACTGGTA
TCCAGAAAAACCATCGAAAGGACAGGCCTACAGATGTATTCGTGTCAATAAATTTCAGAGAGTTGATCCT
GATGTCCTGAAAGCCTGTGAAAACAGCTGCATCTTGTATAGTGACCTGGGCTTGCCAAAGGAGCTCACTC
TCTGGGTGGACCCATGTGAGGTGTGCTGTCGGTATGGAGAGAAAAACAATGCATTCATTGTTGCCAGCTT
TGAAAATAAAGATGAGAACAAGGATGAGATCTCCAGGAAAGTTACCAGGGCCCTTGATAAGGTTACCTCT
GATTATCATTCAGGATCCTCTTCTTCAGATGAAGAAACAAGTAAGGAAATGGAAGTGAAACCCAGTTCGG
TGACTGCAGCCGCAAGTCCTGTGTACCAGATTTCAGAACTTATATTTCCACCTCTTCCAATGTGGCACCC
TTTGCCCAGAAAAAAGCCAGGAATGTATCGAGGGAATGGCCATCAGAATCACTATCCTCCTCCTGTTCCA
TTTGGTTATCCAAATCAGGGAAGAAAAAATAAACCATATCGCCCAATTCCAGTGACATGGGTACCTCCTC
CTGGAATGCATTGTGACCGGAATCACTGGATTAATCCTCACATGTTAGCACCTCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221056 representing NM_006806
Red=Cloning site Green=Tags(s)

MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDP
DVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTS
DYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVP
FGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLAPH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006806
ORF Size 756 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006806.1, NM_006806.3, NM_006806.4, NP_006797.3
RefSeq Size 1378 bp
RefSeq ORF 759 bp
Locus ID 10950
Cytogenetics 21q21.1
Domains Anti_proliferat
MW 28.9 kDa
Gene Summary The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Citations (2)

Other Versions

Other products for "BTG3"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Anti-BTG3 Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools