SPANXB1 (NM_032461) Human Tagged ORF Clone

CAT#: RC221009

SPANXB1 (Myc-DDK-tagged)-Human SPANX family, member B1 (SPANXB1)

Product Images

Circular map for RC221009

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY SPANXB1 (Cat# RC221009, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SPANXB1 (Cat# TA811401)(1:2000). Positive lysates LY410096 (100ug) and LC410096 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY410096) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC221009 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified SPANXB1 protein (Cat# TP321009). The protein was produced from HEK293T cells transfected with SPANXB1 cDNA clone (Cat# RC221009) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: SPANXB1
• Synonyms: B1; CT11.2; SPANX-B; SPANXB; SPANXB2; SPANXF1; SPANXF2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC221009 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGCCAACAATCCAGTGTCCGCAGGCTGAAGAGGAGCGTCCCCTGTGAATCCAACGAGGCCAACGAGG
  CCAATGAGGCCAACAAGACGATGCCGGAGACCCCAACTGGGGACTCAGACCCGCAACCTGCTCCTAAAAA
  AATGAAAACATCTGAGTCCTCGACCATACTAGTGGTTCGCTACAGGAGGAACGTGAAAAGAACATCTCCA
  GAGGAACTGGTGAATGACCACGCCCGAGAGAACAGAATCAACCCCGACCAAATGGAGGAGGAGGAATTCA
  TAGAAATAACGACTGAAAGACCTAAAAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC221009 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSP
  EELVNDHARENRINPDQMEEEEFIEITTERPKK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_032461
• ORF Size: 309 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_032461.2, NP_115850.1
• RefSeq Size: 469 bp
• RefSeq ORF: 312 bp
• Locus ID: 728695
• UniProt ID: Q9NS25
• Cytogenetics: Xq27.1
• MW: 11.8 kDa
• Gene Summary: Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular family member contains an additional 18 nucleotides in its coding region compared to the other family members in the same gene cluster. This family member is also subject to gene copy number variation. Although the protein encoded by this gene contains consensus nuclear localization signals, the major site for subcellular localization of expressed protein is in the cytoplasmic droplets of ejaculated spermatozoa. This protein provides a biochemical marker for studying the unique structures in spermatazoa, while attempting to further define its role in spermatogenesis. [provided by RefSeq, Apr 2014]