VCX3A (NM_016379) Human Tagged ORF Clone

CAT#: RC221002

VCX3A (Myc-DDK-tagged)-Human variable charge, X-linked 3A (VCX3A)

Product Images

Circular map for RC221002

• 

  Western blot validation of overexpression lysate (Cat# LY413983) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC221002 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified VCX3A protein (Cat# TP321002). The protein was produced from HEK293T cells transfected with VCX3A cDNA clone (Cat# RC221002) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: VCX3A
• Synonyms: VCX-8r; VCX-A; VCX3; VCX8R; VCXA
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC221002 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTCCAAAGCCGAGAGCCTCGGGACCTCCGGCCAAGGCCAGGGAGGCAGGAAAGAGGAAGTCCTCCT
  CTCAGCCGAGCCCCAGTGACCCGAAGAAGAAGACTACCAAGGTGGCCAAGAAGGGAAAAGCAGTTCGTAG
  AGGGAGACGCGGGAAGAAAGGGGCTGCGACAAAGATGGCGGCCGTGACGGCACCTGAGGCGGAGAGCGGG
  CCAGCGGCACCCGGCCCCAGCGACCAGCCCAGCCAGGAGCTCCCTCAGCACGAGCTGCCGCCGGAGGAGC
  CAGTGAGCGAGGGGACCCAGCACGACCCCCCGAGTCAGGAGAGCCAGCTGGAGGAACCACTGAGTCAGGA
  GAGCGAGGTGGAAGAACCACTGAGTCAGGAGAGCCAGGTGGAGGAACCACTGAGTCAGGAGAGCGAGGTG
  GAGGAACCACTGAGTCAGGAGAGCCAGGTGGAGGAACCACTGAGTCAGGAGAGCGAGATGGAAGAACCAC
  TGAGTCAGGAGAGCCAGGTGGAGGAACCACCGAGTCAGGAGAGCGAGATGGAAGAACTACCGAGTGTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC221002 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPKPRASGPPAKAREAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG
  PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPPSQESQLEEPLSQESEVEEPLSQESQVEEPLSQESEV
  EEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_016379
• ORF Size: 558 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_016379.4
• RefSeq Size: 1004 bp
• RefSeq ORF: 561 bp
• Locus ID: 51481
• UniProt ID: Q9NNX9
• Cytogenetics: Xp22.31
• MW: 20.1 kDa
• Gene Summary: This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq, Jul 2008]