NUMB (NM_001005743) Human Tagged ORF Clone

CAT#: RC220960

Reviews ()
Write a review

NUMB (Myc-DDK-tagged)-Human numb homolog (Drosophila) (NUMB), transcript variant 1



  "NM_001005743" in other vectors (6)

Reconstitution Protocol

USD 909.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "NUMB"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NUMB
Synonyms C14orf41; c14_5527; S171
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220960 representing NM_001005743
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACAAATTACGGCAAAGTTTTAGGAGAAAGAAGGATGTTTATGTTCCAGAGGCCAGTCGTCCACATC
AGTGGCAGACAGATGAAGAAGGCGTTCGCACCGGAAAATGTAGCTTCCCGGTTAAGTACCTTGGCCATGT
AGAAGTTGATGAATCAAGAGGAATGCACATCTGTGAAGATGCTGTAAAAAGATTGAAAGCTGAAAGGAAG
TTCTTCAAAGGCTTCTTTGGAAAAACTGGAAAGAAAGCAGTTAAAGCAGTTCTGTGGGTCTCAGCAGATG
GACTCAGAGTTGTGGATGAAAAAACTAAGGACCTCATAGTTGACCAGACGATAGAGAAAGTTTCTTTCTG
TGCCCCAGACAGGAACTTTGATAGAGCCTTTTCTTACATATGCCGTGATGGCACCACTCGTCGCTGGATC
TGTCACTGCTTCATGGCTGTCAAGGACACAGGTGAAAGGTTGAGCCATGCAGTAGGCTGTGCTTTTGCAG
CCTGTTTAGAGCGCAAGCAGAAGCGGGAGAAGGAATGTGGAGTGACTGCTACTTTTGATGCTAGTCGGAC
CACTTTTACAAGAGAAGGATCATTCCGTGTCACAACAGCCACTGAACAAGCAAAAAGAGAGGAGATCATG
AAACAAATGCAAGATGCCAAGAAAGCTGAAACAGATAAGATAGTCGTTGGTTCATCAGTTGCCCCTGGCA
ACACTGCCCCATCCCCATCCTCTCCCACCTCTCCTACTTCTGATGCCACGACCTCTCTGGAGATGAACAA
TCCTCATGCCATCCCACGCCGGCATGCTCCAATTGAACAGCTTGCTCGCCAAGGCTCTTTCCGAGGTTTT
CCTGCTCTTAGCCAGAAGATGTCACCCTTTAAACGCCAACTATCCCTACGCATCAATGAGTTGCCTTCCA
CTATGCAGAGGAAGACTGATTTCCCCATTAAAAATGCAGTGCCAGAAGTAGAAGGGGAGGCAGAGAGCAT
CAGCTCCCTGTGCTCACAGATCACCAATGCCTTCAGCACACCTGAGGACCCCTTCTCATCTGCTCCGATG
ACCAAACCAGTGACAGTGGTGGCACCACAATCTCCTACCTTCCAAGCTAATGGCACTGACTCAGCCTTCC
ATGTGCTTGCTAAGCCAGCCCATACTGCTCTAGCACCCGTAGCAATGCCTGTGCGTGAAACCAACCCTTG
GGCCCATGCCCCTGATGCTGCTAACAAGGAAATTGCAGCCACATGTTCGGGGACCGAGTGGGGTCAATCT
TCTGGTGCTGCCTCTCCAGGTCTCTTCCAGGCCGGTCATAGACGTACTCCCTCTGAGGCCGACCGATGGT
TAGAAGAGGTGTCTAAGAGCGTCCGGGCTCAGCAGCCCCAGGCCTCAGCTGCTCCTCTGCAGCCAGTTCT
CCAGCCTCCTCCACCCACTGCCATCTCCCAGCCAGCATCACCTTTCCAAGGGAATGCATTCCTCACCTCT
CAGCCTGTGCCAGTGGGTGTGGTCCCAGCCCTGCAACCAGCCTTTGTCCCTGCCCAGTCCTATCCTGTGG
CCAATGGAATGCCCTATCCAGCCCCTAATGTGCCTGTGGTGGGCATCACTCCCTCCCAGATGGTGGCCAA
CGTATTTGGCACTGCAGGCCACCCTCAGGCTGCCCATCCCCATCAGTCACCCAGCCTGGTCAGGCAGCAG
ACATTCCCTCACTACGAGGCAAGCAGTGCTACCACCAGTCCCTTCTTTAAGCCTCCTGCTCAGCACCTCA
ACGGTTCTGCAGCTTTCAATGGTGTAGATGATGGCAGGTTGGCCTCAGCAGACAGGCATACAGAGGTTCC
TACAGGCACCTGCCCAGTGGATCCTTTTGAAGCCCAGTGGGCTGCATTAGAAAATAAGTCCAAGCAGCGT
ACTAATCCCTCCCCTACCAACCCTTTCTCCAGTGACTTACAGAAGACGTTTGAAATTGAACTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220960 representing NM_001005743
Red=Cloning site Green=Tags(s)

MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERK
FFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWI
CHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAKREEIM
KQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGF
PALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPM
TKPVTVVAPQSPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS
SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTS
QPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQ
TFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQR
TNPSPTNPFSSDLQKTFEIEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001005743
ORF Size 1953 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001005743.1, NP_001005743.1
RefSeq Size 3647 bp
RefSeq ORF 1956 bp
Locus ID 8650
UniProt ID P49757
Cytogenetics 14q24.2-q24.3
Protein Pathways Notch signaling pathway
MW 70.6 kDa
Gene Summary The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.