NRP2 (NM_003872) Human Tagged ORF Clone

CAT#: RC220706

Reviews ()
Write a review

NRP2 (Myc-DDK-tagged)-Human neuropilin 2 (NRP2), transcript variant 2



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 851.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NRP2
Synonyms NP2; NPN2; PRO2714; VEGF165R2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220706 representing NM_003872
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATATGTTTCCTCTCACCTGGGTTTTCTTAGCCCTCTACTTTTCAAGACACCAAGTGAGAGGCCAAC
CAGACCCACCGTGCGGAGGTCGTTTGAATTCCAAAGATGCTGGCTATATCACCTCTCCCGGTTACCCCCA
GGACTACCCCTCCCACCAGAACTGCGAGTGGATTGTTTACGCCCCCGAACCCAACCAGAAGATTGTCCTC
AACTTCAACCCTCACTTTGAAATCGAGAAGCACGACTGCAAGTATGACTTTATCGAGATTCGGGATGGGG
ACAGTGAATCCGCAGACCTCCTGGGCAAACACTGTGGGAACATCGCCCCGCCCACCATCATCTCCTCGGG
CTCCATGCTCTACATCAAGTTCACCTCCGACTACGCCCGGCAGGGGGCAGGCTTCTCTCTGCGCTACGAG
ATCTTCAAGACAGGCTCTGAAGATTGCTCAAAAAACTTCACAAGCCCCAACGGGACCATCGAATCTCCTG
GGTTTCCTGAGAAGTATCCACACAACTTGGACTGCACCTTTACCATCCTGGCCAAACCCAAGATGGAGAT
CATCCTGCAGTTCCTGATCTTTGACCTGGAGCATGACCCTTTGCAGGTGGGAGAGGGGGACTGCAAGTAC
GATTGGCTGGACATCTGGGATGGCATTCCACATGTTGGCCCCCTGATTGGCAAGTACTGTGGGACCAAAA
CACCCTCTGAACTTCGTTCATCGACGGGGATCCTCTCCCTGACCTTTCACACGGACATGGCGGTGGCCAA
GGATGGCTTCTCTGCGCGTTACTACCTGGTCCACCAAGAGCCACTAGAGAACTTTCAGTGCAATGTTCCT
CTGGGCATGGAGTCTGGCCGGATTGCTAATGAACAGATCAGTGCCTCATCTACCTACTCTGATGGGAGGT
GGACCCCTCAACAAAGCCGGCTCCATGGTGATGACAATGGCTGGACCCCCAACTTGGATTCCAACAAGGA
GTATCTCCAGGTGGACCTGCGCTTTTTAACCATGCTCACGGCCATCGCAACACAGGGAGCGATTTCCAGG
GAAACACAGAATGGCTACTACGTCAAATCCTACAAGCTGGAAGTCAGCACTAATGGAGAGGACTGGATGG
TGTACCGGCATGGCAAAAACCACAAGGTATTTCAAGCCAACAACGATGCAACTGAGGTGGTTCTGAACAA
GCTCCACGCTCCACTGCTGACAAGGTTTGTTAGAATCCGCCCTCAGACCTGGCACTCAGGTATCGCCCTC
CGGCTGGAGCTCTTCGGCTGCCGGGTCACAGATGCTCCCTGCTCCAACATGCTGGGGATGCTCTCAGGCC
TCATTGCAGACTCCCAGATCTCCGCCTCTTCCACCCAGGAATACCTCTGGAGCCCCAGTGCAGCCCGCCT
GGTCAGCAGCCGCTCGGGCTGGTTCCCTCGAATCCCTCAGGCCCAGCCCGGTGAGGAGTGGCTTCAGGTA
GATCTGGGAACACCCAAGACAGTGAAAGGTGTCATCATCCAGGGAGCCCGCGGAGGAGACAGTATCACTG
CTGTGGAAGCCAGAGCATTTGTGCGCAAGTTCAAAGTCTCCTACAGCCTAAACGGCAAGGACTGGGAATA
CATTCAGGACCCCAGGACCCAGCAGCCAAAGCTGTTCGAAGGGAACATGCACTATGACACCCCGGACATC
CGAAGGTTTGACCCCATTCCGGCACAGTATGTGCGGGTATACCCGGAGAGGTGGTCGCCGGCGGGGATTG
GGATGCGGCTGGAGGTGCTGGGCTGTGACTGGACAGACTCCAAGCCCACGGTAGAGACGCTGGGACCCAC
TGTGAAGAGCGAAGAGACAACCACCCCCTACCCCACCGAAGAGGAGGCCACAGAGTGTGGGGAGAACTGC
AGCTTTGAGGATGACAAAGATTTGCAGCTCCCTTCGGGATTCAATTGCAACTTCGATTTCCTCGAGGAGC
CCTGTGGTTGGATGTATGACCATGCCAAGTGGCTCCGGACCACCTGGGCCAGCAGCTCCAGCCCAAACGA
CCGGACGTTTCCAGATGACAGGAATTTCTTGCGGCTGCAGAGTGACAGCCAGAGAGAGGGCCAGTATGCC
CGGCTCATCAGCCCCCCTGTCCACCTGCCCCGAAGCCCGGTGTGCATGGAGTTCCAGTACCAGGCCACGG
GCGGCCGCGGGGTGGCGCTGCAGGTGGTGCGGGAAGCCAGCCAGGAGAGCAAGTTGCTGTGGGTCATCCG
TGAGGACCAGGGCGGCGAGTGGAAGCACGGGCGGATCATCCTGCCCAGCTACGACATGGAGTACCAGATT
GTGTTCGAGGGAGTGATAGGGAAAGGACGTTCCGGAGAGATTGCCATTGATGACATTCGGATAAGCACTG
ATGTCCCACTGGAGAACTGCATGGAACCCATCTCGGCTTTTGCAGTGGACATCCCAGAAATACATGAGAG
AGAAGGATATGAAGATGAAATTGATGATGAATACGAGGTGGACTGGAGCAATTCTTCTTCTGCAACCTCA
GGGTCTGGCGCCCCCTCGACCGACAAAGAAAAGAGCTGGCTGTACACCCTGGATCCCATCCTCATCACCA
TCATCGCCATGAGCTCACTGGGCGTCCTCCTGGGGGCCACCTGTGCAGGCCTCCTGCTCTACTGCACCTG
TTCCTACTCGGGCCTGAGCTCCCGAAGCTGCACCACACTGGAGAACTACAACTTCGAGCTCTACGATGGC
CTTAAGCACAAGGTCAAGATGAACCACCAAAAGTGCTGCTCCGAGGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220706 representing NM_003872
Red=Cloning site Green=Tags(s)

MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVL
NFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYE
IFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKY
DWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVP
LGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISR
ETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQV
DLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDI
RRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPTEEEATECGENC
SFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYA
RLISPPVHLPRSPVCMEFQYQATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQI
VFEGVIGKGRSGEIAIDDIRISTDVPLENCMEPISAFAVDIPEIHEREGYEDEIDDEYEVDWSNSSSATS
GSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLENYNFELYDG
LKHKVKMNHQKCCSEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003872
ORF Size 2778 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003872.3
RefSeq Size 6656 bp
RefSeq ORF 2781 bp
Locus ID 8828
UniProt ID O60462
Cytogenetics 2q33.3
Protein Families Druggable Genome, Transmembrane
MW 104.26 kDa
Gene Summary This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Other products for "NRP2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.