ErbB 4 (ERBB4) (NM_005235) Human Tagged ORF Clone

CAT#: RC220449

Reviews ()
Write a review

ERBB4 (Myc-DDK-tagged)-Human v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) (ERBB4), transcript variant JM-a/CVT-1



  "NM_005235" in other vectors (8)

Reconstitution Protocol

USD 1,138.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "ERBB4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ERBB4
Synonyms ALS19; HER4; p180erbB4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220449 representing NM_005235
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCCGGCGACAGGACTTTGGGTCTGGGTGAGCCTTCTCGTGGCGGCGGGGACCGTCCAGCCCAGCG
ATTCTCAGTCAGTGTGTGCAGGAACGGAGAATAAACTGAGCTCTCTCTCTGACCTGGAACAGCAGTACCG
AGCCTTGCGCAAGTACTATGAAAACTGTGAGGTTGTCATGGGCAACCTGGAGATAACCAGCATTGAGCAC
AACCGGGACCTCTCCTTCCTGCGGTCTGTTCGAGAAGTCACAGGCTACGTGTTAGTGGCTCTTAATCAGT
TTCGTTACCTGCCTCTGGAGAATTTACGCATTATTCGTGGGACAAAACTTTATGAGGATCGATATGCCTT
GGCAATATTTTTAAACTACAGAAAAGATGGAAACTTTGGACTTCAAGAACTTGGATTAAAGAACTTGACA
GAAATCCTAAATGGTGGAGTCTATGTAGACCAGAACAAATTCCTTTGTTATGCAGACACCATTCATTGGC
AAGATATTGTTCGGAACCCATGGCCTTCCAACTTGACTCTTGTGTCAACAAATGGTAGTTCAGGATGTGG
ACGTTGCCATAAGTCCTGTACTGGCCGTTGCTGGGGACCCACAGAAAATCATTGCCAGACTTTGACAAGG
ACGGTGTGTGCAGAACAATGTGACGGCAGATGCTACGGACCTTACGTCAGTGACTGCTGCCATCGAGAAT
GTGCTGGAGGCTGCTCAGGACCTAAGGACACAGACTGCTTTGCCTGCATGAATTTCAATGACAGTGGAGC
ATGTGTTACTCAGTGTCCCCAAACCTTTGTCTACAATCCAACCACCTTTCAACTGGAGCACAATTTCAAT
GCAAAGTACACATATGGAGCATTCTGTGTCAAGAAATGTCCACATAACTTTGTGGTAGATTCCAGTTCTT
GTGTGCGTGCCTGCCCTAGTTCCAAGATGGAAGTAGAAGAAAATGGGATTAAAATGTGTAAACCTTGCAC
TGACATTTGCCCAAAAGCTTGTGATGGCATTGGCACAGGATCATTGATGTCAGCTCAGACTGTGGATTCC
AGTAACATTGACAAATTCATAAACTGTACCAAGATCAATGGGAATTTGATCTTTCTAGTCACTGGTATTC
ATGGGGACCCTTACAATGCAATTGAAGCCATAGACCCAGAGAAACTGAACGTCTTTCGGACAGTCAGAGA
GATAACAGGTTTCCTGAACATACAGTCATGGCCACCAAACATGACTGACTTCAGTGTTTTTTCTAACCTG
GTGACCATTGGTGGAAGAGTACTCTATAGTGGCCTGTCCTTGCTTATCCTCAAGCAACAGGGCATCACCT
CTCTACAGTTCCAGTCCCTGAAGGAAATCAGCGCAGGAAACATCTATATTACTGACAACAGCAACCTGTG
TTATTATCATACCATTAACTGGACAACACTCTTCAGCACAATCAACCAGAGAATAGTAATCCGGGACAAC
AGAAAAGCTGAAAATTGTACTGCTGAAGGAATGGTGTGCAACCATCTGTGTTCCAGTGATGGCTGTTGGG
GACCTGGGCCAGACCAATGTCTGTCGTGTCGCCGCTTCAGTAGAGGAAGGATCTGCATAGAGTCTTGTAA
CCTCTATGATGGTGAATTTCGGGAGTTTGAGAATGGCTCCATCTGTGTGGAGTGTGACCCCCAGTGTGAG
AAGATGGAAGATGGCCTCCTCACATGCCATGGACCGGGTCCTGACAACTGTACAAAGTGCTCTCATTTTA
AAGATGGCCCAAACTGTGTGGAAAAATGTCCAGATGGCTTACAGGGGGCAAACAGTTTCATTTTCAAGTA
TGCTGATCCAGATCGGGAGTGCCACCCATGCCATCCAAACTGCACCCAAGGGTGTAACGGTCCCACTAGT
CATGACTGCATTTACTACCCATGGACGGGCCATTCCACTTTACCACAACATGCTAGAACTCCCCTGATTG
CAGCTGGAGTAATTGGTGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAG
GAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGAAACAGAGTTGGTGGAACCATTAACTCCC
AGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGTAAAAGTCC
TTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCC
TGTGGCTATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTG
ATCATGGCAAGTATGGATCATCCACACCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGC
TGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCACGAGCACAAGGATAACATTGGATC
ACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACTCGTT
CATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGC
TAGCCAGACTCTTGGAAGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGAT
GGCTCTGGAGTGTATACATTACAGGAAATTCACCCATCAGAGTGACGTTTGGAGCTATGGAGTTACTATA
TGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAATCCCTGATTTATTAG
AGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTG
GATGATTGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGAC
CCTCAAAGATACCTAGTTATTCAGGGTGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCT
TTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGCTGAGGAGTACTTGGTCCCTCAGGC
TTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAGTGAAATTGGACAC
AGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTG
AACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGC
TACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGGCACCCCATGTCCAA
GAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAG
AGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGA
GGAGAACCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAAT
GCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCA
ACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAGCGTT
TGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCTGCAG
GAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAAT
ACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGCTGCCGCCTCCACCTTACAGACACCGGAATACTGT
GGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220449 representing NM_005235
Red=Cloning site Green=Tags(s)

MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEH
NRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLT
EILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTR
TVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFN
AKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDS
SNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDN
RKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCE
KMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTS
HDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTP
SGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEAL
IMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTI
WELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARD
PQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGH
SPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQ
EDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHN
ASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005235
ORF Size 3924 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005235.3
RefSeq Size 5484 bp
RefSeq ORF 3927 bp
Locus ID 2066
UniProt ID Q15303
Cytogenetics 2q34
Domains Recep_L_domain, pkinase, TyrKc, S_TKc, YLP, Furin-like, FU
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Calcium signaling pathway, Endocytosis, ErbB signaling pathway
MW 146.81 kDa
Gene Summary This gene is a member of the Tyr protein kinase family and the epidermal growth factor receptor subfamily. It encodes a single-pass type I membrane protein with multiple cysteine rich domains, a transmembrane domain, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domain binding motif. The protein binds to and is activated by neuregulins and other factors and induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.