Huntingtin Associated Protein 1(HAP1) (NM_177977) Human Tagged ORF Clone

CAT#: RC220251

HAP1 (Myc-DDK-tagged)-Human huntingtin-associated protein 1 (HAP1), transcript variant 2

  View "NM_177977" in other vectors (10)

USD 410.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Huntingtin Associated Protein 1(HAP1) (NM_177977) Human Tagged ORF Clone
Symbol HAP1
Synonyms HAP2; hHLP1; HIP5; HLP
Vector pCMV6-Entry
Sequence Data
>RC220251 representing NM_177977
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCCCGAAGAGGTTGGGCCGGTGCTGCGCGGGGAGCCGGCTCGGACCCGGGGACCCAGCAGCACTCA
CCTGTGCACCTTCGCCCTCAGCCAGTCCCGCTCCGGAGCCCTCTGCGCAGCCGCAGGCACGGGGCACTGG
ACAGAGAGTAGGATCCCGAGCCACCTCTGGATCCCAGTTCCTCTCGGAAGCCCGCACCGGAGCTCGCCCG
GCCTCGGAGGCTGGAGCCAAGGCAGGAGCCCGGCGCCCGTCCGCATTCTCGGCCATCCAAGGGGATGTCC
GGTCTATGCCCGACAATTCGGACGCGCCGTGGACCCGCTTCGTATTCCAAGGGCCGTTTGGTTCCCGGGC
CACTGGCCGGGGGACTGGAAAGGCAGCGGGCATCTGGAAGACGCCAGCCGCCTACGTTGGCCGGCGACCC
GGGGTGTCCGGCCCTGAGCGCGCCGCCTTTATTCGGGAGCTGGAGGAAGCACTGTGTCCTAACCTACCTC
CGCCAGTCAAAAAGATCACCCAGGAAGACGTCAAAGTGATGTTATATTTGCTGGAGGAGCTTCTCCCACC
TGTCTGGGAGAGCGTTACCTATGGGATGGTCCTGCAGAGAGAGAGGGACCTGAACACTGCAGCTCGCATC
GGCCAGTCCCTGGTGAAACAGAACAGTGTTTTGATGGAGGAGAACAGCAAGCTGGAAGCCCTGCTGGGCT
CAGCCAAGGAGGAGATTTTATACCTCAGACACCAGGTGAACTTGCGGGATGAGCTCCTCCAGCTCTACTC
AGATTCTGATGAGGAGGATGAGGATGAAGAAGAGGAGGAGGAAGAAAAGGAGGCAGAAGAGGAACAGGAA
GAAGAAGAAGCAGAGGAAGACCTGCAGTGTGCTCATCCCTGTGATGCCCCTAAGCTGATTTCGCAGGAGG
CATTGCTGCACCAGCACCACTGCCCACAGCTGGAAGCCTTGCAGGAGAAGCTGAGGCTGCTGGAGGAGGA
GAATCATCAGCTGAGAGAAGAGGCCTCTCAACTCGACACTCTTGAGGATGAGGAACAGATGCTCATTCTG
GAGTGTGTGGAGCAGTTTTCGGAGGCCAGCCAACAGATGGCTGAGCTGTCGGAGGTGCTGGTGCTCAGGC
TGGAAAACTATGAACGGCAGCAGCAGGAGGTCGCTCGGCTGCAGGCCCAGGTGCTGAAGCTGCAGCAGCG
CTGCCGGATGTATGGGGCTGAGACTGAAAAGTTGCAGAAGCAGCTGGCTTCGGAGAAGGAAATCCAGATG
CAGCTCCAGGAAGAGGAGACTCTTCCTGGTTTCCAGGAGACGCTGGCTGAGGAGCTCAGAACGTCTCTAA
GGAGGATGATCTCAGACCCTGTGTATTTTATGGAGAGGAATTATGAGATGCCCAGAGGGGACACATCCAG
CCTAAGGTATGATTTTCGCTACAGTGAGGATCGAGAGCAGGTGCGGGGGTTTGAGGCTGAGGAAGGGTTG
ATGCTGGCAGCGGATATCATGCGGGGGGAAGATTTCACGCCTGCGGAGGAGTTCGTGCCCCAGGAGGAGC
TGGGGGCTGCCAAGAAGGTGCCGGCTGAGGAAGGGGTGATGGAAGAGGCAGAGCTGGTGTCAGAGGAGAC
CGAGGGCTGGGAGGAGGTGGAACTGGAGCTGGATGAGGCAACGCGGATGAACGTGGTGACATCAGCCCTG
GAGGCCAGCGGCTTGGGCCCTTCACACCTGGACATGAATTATGTCCTCCAGCAGCTGGCCAACTGGCAAG
ATGCCCATTACAGGCGGCAGCTGAGGTGGAAGATGCTCCAGAAAGGTGAGTGCCCCCACGGGGCCCTCCC
TGCCGCCAGCCGGACAAGCTGCAGATCGTCGTGCCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220251 representing NM_177977
Red=Cloning site Green=Tags(s)

MRPKRLGRCCAGSRLGPGDPAALTCAPSPSASPAPEPSAQPQARGTGQRVGSRATSGSQFLSEARTGARP
ASEAGAKAGARRPSAFSAIQGDVRSMPDNSDAPWTRFVFQGPFGSRATGRGTGKAAGIWKTPAAYVGRRP
GVSGPERAAFIRELEEALCPNLPPPVKKITQEDVKVMLYLLEELLPPVWESVTYGMVLQRERDLNTAARI
GQSLVKQNSVLMEENSKLEALLGSAKEEILYLRHQVNLRDELLQLYSDSDEEDEDEEEEEEEKEAEEEQE
EEEAEEDLQCAHPCDAPKLISQEALLHQHHCPQLEALQEKLRLLEEENHQLREEASQLDTLEDEEQMLIL
ECVEQFSEASQQMAELSEVLVLRLENYERQQQEVARLQAQVLKLQQRCRMYGAETEKLQKQLASEKEIQM
QLQEEETLPGFQETLAEELRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYSEDREQVRGFEAEEGL
MLAADIMRGEDFTPAEEFVPQEELGAAKKVPAEEGVMEEAELVSEETEGWEEVELELDEATRMNVVTSAL
EASGLGPSHLDMNYVLQQLANWQDAHYRRQLRWKMLQKGECPHGALPAASRTSCRSSCR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_177977
ORF Size 1857 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_177977.1, NM_177977.2, NP_817084
RefSeq Size 3981
RefSeq ORF 1860
Locus ID 9001
Cytogenetics 17q21.2
Protein Pathways Huntington's disease
MW 69.5 kDa
Gene Summary Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein that interacts with huntingtin, with two cytoskeletal proteins (dynactin and pericentriolar autoantigen protein 1), and with a hepatocyte growth factor-regulated tyrosine kinase substrate. The interactions with cytoskeletal proteins and a kinase substrate suggest a role for this protein in vesicular trafficking or organelle transport. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "HAP1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


Rabbit Polyclonal HAP1 Antibody
    • 100 ug

USD 415.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones