Nucleolin (NCL) (NM_005381) Human Tagged ORF Clone

CAT#: RC219082

  • TrueORF®

NCL (Myc-DDK-tagged)-Human nucleolin (NCL)

 Cited in 1 publication.

  View "NM_005381" in other vectors (10)

USD 1,110.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Nucleolin (NCL) (NM_005381) Human Tagged ORF Clone
Symbol NCL
Synonyms C23
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC219082 representing NM_005381
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGAAGCTCGCGAAGGCAGGTAAAAATCAAGGTGACCCCAAGAAAATGGCTCCTCCTCCAAAGGAGG
TAGAAGAAGATAGTGAAGATGAGGAAATGTCAGAAGATGAAGAAGATGATAGCAGTGGAGAAGAGGTCGT
CATACCTCAGAAGAAAGGCAAGAAGGCTGCTGCAACCTCAGCAAAGAAGGTGGTCGTTTCCCCAACAAAA
AAGGTTGCAGTTGCCACACCAGCCAAGAAAGCAGCTGTCACTCCAGGCAAAAAGGCAGCAGCAACACCTG
CCAAGAAGACAGTTACACCAGCCAAAGCAGTTACCACACCTGGCAAGAAGGGAGCCACACCAGGCAAAGC
ATTGGTAGCAACTCCTGGTAAGAAGGGTGCTGCCATCCCAGCCAAGGGGGCAAAGAATGGCAAGAATGCC
AAGAAGGAAGACAGTGATGAAGAGGAGGATGATGACAGTGAGGAGGATGAGGAGGATGACGAGGACGAGG
ATGAGGATGAAGATGAAATTGAACCAGCAGCGATGAAAGCAGCAGCTGCTGCCCCTGCCTCAGAGGATGA
GGACGATGAGGATGACGAAGATGATGAGGATGACGATGACGATGAGGAAGATGACTCTGAAGAAGAAGCT
ATGGAGACTACACCAGCCAAAGGAAAGAAAGCTGCAAAAGTTGTTCCTGTGAAAGCCAAGAACGTGGCTG
AGGATGAAGATGAAGAAGAGGATGATGAGGACGAGGATGACGACGACGACGAAGATGATGAAGATGATGA
TGATGAAGATGATGAGGAGGAGGAAGAAGAGGAGGAGGAAGAGCCTGTCAAAGAAGCACCTGGAAAACGA
AAGAAGGAAATGGCCAAACAGAAAGCAGCTCCTGAAGCCAAGAAACAGAAAGTGGAAGGCACAGAACCGA
CTACGGCTTTCAATCTCTTTGTTGGAAACCTAAACTTTAACAAATCTGCTCCTGAATTAAAAACTGGTAT
CAGCGATGTTTTTGCTAAAAATGATCTTGCTGTTGTGGATGTCAGAATTGGTATGACTAGGAAATTTGGT
TATGTGGATTTTGAATCTGCTGAAGACCTGGAGAAAGCGTTGGAACTCACTGGTTTGAAAGTCTTTGGCA
ATGAAATTAAACTAGAGAAACCAAAAGGAAAAGACAGTAAGAAAGAGCGAGATGCGAGAACACTTTTGGC
TAAAAATCTCCCTTACAAAGTCACTCAGGATGAATTGAAAGAAGTGTTTGAAGATGCTGCGGAGATCAGA
TTAGTCAGCAAGGATGGGAAAAGTAAAGGGATTGCTTATATTGAATTTAAGACAGAAGCTGATGCAGAGA
AAACCTTTGAAGAAAAGCAGGGAACAGAGATCGATGGGCGATCTATTTCCCTGTACTATACTGGAGAGAA
AGGTCAAAATCAAGACTATAGAGGTGGAAAGAATAGCACTTGGAGTGGTGAATCAAAAACTCTGGTTTTA
AGCAACCTCTCCTACAGTGCAACAGAAGAAACTCTTCAGGAAGTATTTGAGAAAGCAACTTTTATCAAAG
TACCCCAGAACCAAAATGGCAAATCTAAAGGGTATGCATTTATAGAGTTTGCTTCATTCGAAGACGCTAA
AGAAGCTTTAAATTCCTGTAATAAAAGGGAAATTGAGGGCAGAGCAATCAGGCTGGAGTTGCAAGGACCC
AGGGGATCACCTAATGCCAGAAGCCAGCCATCCAAAACTCTGTTTGTCAAAGGCCTGTCTGAGGATACCA
CTGAAGAGACATTAAAGGAGTCATTTGACGGCTCCGTTCGGGCAAGGATAGTTACTGACCGGGAAACTGG
GTCCTCCAAAGGGTTTGGTTTTGTAGACTTCAACAGTGAGGAGGATGCCAAAGCTGCCAAGGAGGCCATG
GAAGACGGTGAAATTGATGGAAATAAAGTTACCTTGGACTGGGCCAAACCTAAGGGTGAAGGTGGCTTCG
GGGGTCGTGGTGGAGGCAGAGGCGGCTTTGGAGGACGAGGTGGTGGTAGAGGAGGCCGAGGAGGATTTGG
TGGCAGAGGCCGGGGAGGCTTTGGAGGGCGAGGAGGCTTCCGAGGAGGCAGAGGAGGAGGAGGTGACCAC
AAGCCACAAGGAAAGAAGACGAAGTTTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219082 representing NM_005381
Red=Cloning site Green=Tags(s)

MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTK
KVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNA
KKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEA
METTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKR
KKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFG
YVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR
LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVL
SNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGP
RGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAM
EDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDH
KPQGKKTKFE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005381
ORF Size 2130 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005381.1, NM_005381.2, NP_005372
RefSeq Size 2732
RefSeq ORF 2133
Locus ID 4691
Cytogenetics 2q37.1
Domains rrm
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Pathogenic Escherichia coli infection
MW 76.4 kDa
Gene Summary Nucleolin (NCL), a eukaryotic nucleolar phosphoprotein, is involved in the synthesis and maturation of ribosomes. It is located mainly in dense fibrillar regions of the nucleolus. Human NCL gene consists of 14 exons with 13 introns and spans approximately 11kb. The intron 11 of the NCL gene encodes a small nucleolar RNA, termed U20. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


Rabbit Polyclonal Nucleolin Antibody
    • 0.1 ml

USD 415.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones