DOC2B (NM_003585) Human Tagged ORF Clone

CAT#: RC218949

DOC2B (Myc-DDK-tagged)-Human double C2-like domains, beta (DOC2B)

Change vector?

USD 536


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DOC2B (NM_003585) Human Tagged ORF Clone
Symbol DOC2B
Synonyms DOC2BL; DOC2BL
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC218949 representing NM_003585
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCTCCGGCGGCGCGGGGAGAAGGCGACCATCAGCATCCAGGAGCATATGGCCATCGACGTGTGCC
CCGGCCCCATCCGTCCCATCAAGCAGATCTCCGACTACTTCCCCCGCTTCCCGCGGGGCCTGCCCCCGGA
CGCCGGGCCCCGAGCCGCTGCACCCCCGGACGCCCCCGCGCGCCCGGCTGTGGCCGGTGCCGGCCGCCGC
AGCCCCTCCGACGGCGCCCGCGAGGACGACGAGGATGTGGACCAGCTCTTCGGAGCCTACGGCTCCAGCC
CGGGCCCCAGCCCGGGTCCCAGCCCCGCGCGGCCGCCAGCCAAGCCGCCGGAGGACGAGCCGGACGCCGA
CGGCTACGAGTCGGACGACTGCACTGCCCTGGGCACGCTGGACTTCAGCCTGCTGTATGACCAGGAGAAC
AACGCCCTCCACTGCACCATCACCAAGGCCAAGGGCCTGAAGCCAATGGACCACAATGGGCTGGCAGACC
CCTACGTCAAGCTGCACCTGCTGCCAGGAGCCAGTAAGGCAAATAAGCTCAGAACAAAAACTCTCCGTAA
CACTCTGAACCCCACATGGAACGAGACCCTCACTTACTACGGGATCACAGATGAAGACATGATCCGCAAG
ACCCTGCGGATCTCTGTGTGTGACGAGGACAAATTCCGGCACAATGAGTTCATCGGGGAGACACGTGTGC
CCCTGAAGAAGCTGAAACCCAACCACACCAAGACCTTCAGCATCTGCCTGGAGAAGCAGCTGCCGGTGGA
CAAGACCGAAGACAAGTCCCTGGAGGAGCGGGGCCGCATCCTCATCTCGCTCAAGTACAGCTCACAGAAG
CAAGGCCTGCTGGTAGGCATCGTGCGGTGCGCCCACCTGGCCGCCATGGACGCCAACGGCTACTCGGACC
CCTACGTGAAAACATACCTGAGGCCAGATGTGGACAAGAAATCCAAACATAAGACAGCGGTGAAGAAAAA
AACCCTGAACCCGGAGTTTAATGAGGAGTTCTGTTACGAGATCAAGCATGGGGACCTGGCCAAGAAGTCC
CTGGAGGTCACCGTTTGGGATTACGACATTGGAAAATCCAACGATTTCATTGGTGGTGTGGTTCTGGGCA
TCCACGCCAAGGGGGAGCGCCTGAAGCACTGGTTTGACTGCCTGAAGAACAAGGACAAGCGCATCGAGCG
CTGGCACACGCTCACCAGCGAGCTCCCAGGGGCTGTGCTCAGCGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218949 representing NM_003585
Red=Cloning site Green=Tags(s)

MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPDAGPRAAAPPDAPARPAVAGAGRR
SPSDGAREDDEDVDQLFGAYGSSPGPSPGPSPARPPAKPPEDEPDADGYESDDCTALGTLDFSLLYDQEN
NALHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRK
TLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFSICLEKQLPVDKTEDKSLEERGRILISLKYSSQK
QGLLVGIVRCAHLAAMDANGYSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKS
LEVTVWDYDIGKSNDFIGGVVLGIHAKGERLKHWFDCLKNKDKRIERWHTLTSELPGAVLSD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003585
ORF Size 1236 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003585.1, NM_003585.2, NM_003585.3, NM_003585.4, NP_003576
RefSeq Size 2030
RefSeq ORF 1239
Locus ID 8447
Cytogenetics 17p13.3
MW 45.8 kDa
Gene Summary There are at least two protein isoforms of the Double C2 protein, namely alpha (DOC2A) and beta (DOC2B), which contain two C2-like domains. DOC2A and DOC2B are encoded by different genes; these genes are at times confused with the unrelated DAB2 gene which was initially named DOC-2. DOC2B is expressed ubiquitously and is suggested to be involved in Ca(2+)-dependent intracellular vesicle trafficking in various types of cells. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations