NSMase2 (SMPD3) (NM_018667) Human Tagged ORF Clone

CAT#: RC218441

Reviews ()
Write a review

SMPD3 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II) (SMPD3)



  "NM_018667" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SMPD3
Synonyms NSMASE2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218441 representing NM_018667
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTTTGTACACGACCCCCTTTCCTAACAGCTGTCTGTCCGCCCTGCACTGTGTGTCCTGGGCCCTTA
TCTTTCCATGCTACTGGCTGGTGGACCGGCTCGCTGCCTCCTTCATACCCACCACCTACGAGAAGCGCCA
GCGGGCAGACGACCCGTGCTGCCTGCAGCTGCTCTGCACTGCCCTCTTCACGCCCATCTACCTGGCCCTC
CTGGTGGCCTCGCTGCCCTTTGCGTTTCTCGGCTTTCTCTTCTGGTCCCCACTGCAGTCGGCCCGCCGGC
CCTACATCTATTCACGGCTGGAAGACAAGGGCCTGGCCGGTGGGGCAGCCCTGCTCAGTGAATGGAAGGG
CACGGGGCCTGGCAAAAGCTTCTGCTTTGCCACTGCCAACGTCTGCCTCCTGCCCGACTCACTCGCCAGG
GTCAACAACCTTTTTAACACCCAAGCGCGGGCCAAGGAGATCGGGCAGAGAATCCGCAATGGGGCCGCCC
GGCCCCAGATCAAAATTTACATCGACTCCCCCACCAATACCTCCATCAGCGCCGCTAGCTTCAGCAGCCT
GGTGTCACCACAGGGCGGCGATGGGGTGGCCCGGGCCGTCCCCGGGAGCATTAAGAGGACAGCCTCTGTG
GAGTACAAGGGTGACGGTGGGCGGCACCCCGGTGACGAGGCTGCCAACGGCCCAGCCTCTGGGGACCCTG
TCGACAGCAGCAGCCCGGAGGATGCCTGCATCGTGCGCATCGGTGGCGAGGAGGGCGGCCGGCCACCTGA
AGCTGACGACCCTGTGCCTGGGGGCCAGGCCAGGAACGGAGCTGGCGGGGGCCCAAGGGGCCAGACGCCC
AACCATAATCAGCAGGACGGGGATTCAGGGAGCCTGGGCAGCCCCTCGGCCTCCCGGGAGTCCCTGGTGA
AGGGGCGAGCTGGGCCAGACACCAGTGCCAGCGGGGAGCCAGGTGCCAACAGCAAGCTCCTGTACAAGGC
CTCGGTGGTGAAGAAGGCGGCTGCACGCAGGAGGCGGCACCCCGACGAGGCCTTCGACCATGAGGTCTCC
GCCTTCTTCCCCGCCAACCTGGACTTCCTGTGCCTGCAGGAGGTGTTTGACAAGCGAGCAGCCACCAAAT
TGAAAGAGCAGCTGCACGGCTACTTCGAGTACATCCTGTACGACGTCGGGGTCTACGGCTGCCAGGGCTG
CTGCAGCTTCAAGTGTCTCAACAGCGGCCTCCTCTTTGCCAGCCGCTACCCCATCATGGACGTGGCCTAT
CACTGTTACCCCAACAAGTGTAACGACGATGCCCTGGCCTCTAAGGGAGCTCTGTTTCTCAAGGTGCAGG
TGGGAAGCACACCTCAGGACCAAAGAATCGTCGGGTACATCGCCTGCACACACCTGCATGCCCCACAAGA
GGACAGCGCCATCCGGTGTGGGCAGCTGGACCTGCTTCAGGACTGGCTGGCTGATTTCCGAAAATCTACC
TCCTCGTCCAGCGCAGCCAACCCCGAGGAGCTGGTGGCATTTGACGTCGTCTGTGGAGATTTCAACTTTG
ATAACTGCTCCTCTGACGACAAGCTGGAGCAGCAACACTCCCTGTTCACCCACTACAGGGACCCCTGCCG
CCTGGGGCCTGGTGAGGAGAAGCCGTGGGCCATCGGTACTCTGCTGGACACGAACGGCCTGTACGATGAG
GATGTGTGCACCCCCGACAACCTGCAGAAGGTCCTGGAGAGTGAGGAGGGCCGCAGGGAGTACCTGGCGT
TTCCCACCAGCAAGAGCTCGGGCCAGAAGGGGCGGAAGGAGCTGCTGAAGGGCAACGGCCGGCGCATCGA
CTACATGCTGCATGCAGAGGAGGGGCTGTGCCCAGACTGGAAGGCCGAGGTGGAAGAATTCAGTTTTATC
ACCCAGCTGTCCGGCCTGACGGACCACCTGCCAGTAGCCATGCGACTGATGGTGTCTTCGGGGGAGGAGG
AGGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218441 representing NM_018667
Red=Cloning site Green=Tags(s)

MVLYTTPFPNSCLSALHCVSWALIFPCYWLVDRLAASFIPTTYEKRQRADDPCCLQLLCTALFTPIYLAL
LVASLPFAFLGFLFWSPLQSARRPYIYSRLEDKGLAGGAALLSEWKGTGPGKSFCFATANVCLLPDSLAR
VNNLFNTQARAKEIGQRIRNGAARPQIKIYIDSPTNTSISAASFSSLVSPQGGDGVARAVPGSIKRTASV
EYKGDGGRHPGDEAANGPASGDPVDSSSPEDACIVRIGGEEGGRPPEADDPVPGGQARNGAGGGPRGQTP
NHNQQDGDSGSLGSPSASRESLVKGRAGPDTSASGEPGANSKLLYKASVVKKAAARRRRHPDEAFDHEVS
AFFPANLDFLCLQEVFDKRAATKLKEQLHGYFEYILYDVGVYGCQGCCSFKCLNSGLLFASRYPIMDVAY
HCYPNKCNDDALASKGALFLKVQVGSTPQDQRIVGYIACTHLHAPQEDSAIRCGQLDLLQDWLADFRKST
SSSSAANPEELVAFDVVCGDFNFDNCSSDDKLEQQHSLFTHYRDPCRLGPGEEKPWAIGTLLDTNGLYDE
DVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFI
TQLSGLTDHLPVAMRLMVSSGEEEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018667
ORF Size 1965 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018667.2, NP_061137.1
RefSeq Size 5284 bp
RefSeq ORF 1968 bp
Locus ID 55512
UniProt ID Q9NY59
Cytogenetics 16q22.1
Domains Exo_endo_phos
Protein Families Transmembrane
Protein Pathways Metabolic pathways, Sphingolipid metabolism
MW 70.9 kDa
Gene Summary Catalyzes the hydrolysis of sphingomyelin to form ceramide and phosphocholine. Ceramide mediates numerous cellular functions, such as apoptosis and growth arrest, and is capable of regulating these 2 cellular events independently. Also hydrolyzes sphingosylphosphocholine. Regulates the cell cycle by acting as a growth suppressor in confluent cells. Probably acts as a regulator of postnatal development and participates in bone and dentin mineralization.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "SMPD3"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.