NSMase2(SMPD3) (NM_018667) Human Tagged ORF Clone

CAT#: RC218441

SMPD3 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II) (SMPD3)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name NSMase2(SMPD3) (NM_018667) Human Tagged ORF Clone
Symbol SMPD3
Synonyms NSMASE2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC218441 representing NM_018667
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTTTGTACACGACCCCCTTTCCTAACAGCTGTCTGTCCGCCCTGCACTGTGTGTCCTGGGCCCTTA
TCTTTCCATGCTACTGGCTGGTGGACCGGCTCGCTGCCTCCTTCATACCCACCACCTACGAGAAGCGCCA
GCGGGCAGACGACCCGTGCTGCCTGCAGCTGCTCTGCACTGCCCTCTTCACGCCCATCTACCTGGCCCTC
CTGGTGGCCTCGCTGCCCTTTGCGTTTCTCGGCTTTCTCTTCTGGTCCCCACTGCAGTCGGCCCGCCGGC
CCTACATCTATTCACGGCTGGAAGACAAGGGCCTGGCCGGTGGGGCAGCCCTGCTCAGTGAATGGAAGGG
CACGGGGCCTGGCAAAAGCTTCTGCTTTGCCACTGCCAACGTCTGCCTCCTGCCCGACTCACTCGCCAGG
GTCAACAACCTTTTTAACACCCAAGCGCGGGCCAAGGAGATCGGGCAGAGAATCCGCAATGGGGCCGCCC
GGCCCCAGATCAAAATTTACATCGACTCCCCCACCAATACCTCCATCAGCGCCGCTAGCTTCAGCAGCCT
GGTGTCACCACAGGGCGGCGATGGGGTGGCCCGGGCCGTCCCCGGGAGCATTAAGAGGACAGCCTCTGTG
GAGTACAAGGGTGACGGTGGGCGGCACCCCGGTGACGAGGCTGCCAACGGCCCAGCCTCTGGGGACCCTG
TCGACAGCAGCAGCCCGGAGGATGCCTGCATCGTGCGCATCGGTGGCGAGGAGGGCGGCCGGCCACCTGA
AGCTGACGACCCTGTGCCTGGGGGCCAGGCCAGGAACGGAGCTGGCGGGGGCCCAAGGGGCCAGACGCCC
AACCATAATCAGCAGGACGGGGATTCAGGGAGCCTGGGCAGCCCCTCGGCCTCCCGGGAGTCCCTGGTGA
AGGGGCGAGCTGGGCCAGACACCAGTGCCAGCGGGGAGCCAGGTGCCAACAGCAAGCTCCTGTACAAGGC
CTCGGTGGTGAAGAAGGCGGCTGCACGCAGGAGGCGGCACCCCGACGAGGCCTTCGACCATGAGGTCTCC
GCCTTCTTCCCCGCCAACCTGGACTTCCTGTGCCTGCAGGAGGTGTTTGACAAGCGAGCAGCCACCAAAT
TGAAAGAGCAGCTGCACGGCTACTTCGAGTACATCCTGTACGACGTCGGGGTCTACGGCTGCCAGGGCTG
CTGCAGCTTCAAGTGTCTCAACAGCGGCCTCCTCTTTGCCAGCCGCTACCCCATCATGGACGTGGCCTAT
CACTGTTACCCCAACAAGTGTAACGACGATGCCCTGGCCTCTAAGGGAGCTCTGTTTCTCAAGGTGCAGG
TGGGAAGCACACCTCAGGACCAAAGAATCGTCGGGTACATCGCCTGCACACACCTGCATGCCCCACAAGA
GGACAGCGCCATCCGGTGTGGGCAGCTGGACCTGCTTCAGGACTGGCTGGCTGATTTCCGAAAATCTACC
TCCTCGTCCAGCGCAGCCAACCCCGAGGAGCTGGTGGCATTTGACGTCGTCTGTGGAGATTTCAACTTTG
ATAACTGCTCCTCTGACGACAAGCTGGAGCAGCAACACTCCCTGTTCACCCACTACAGGGACCCCTGCCG
CCTGGGGCCTGGTGAGGAGAAGCCGTGGGCCATCGGTACTCTGCTGGACACGAACGGCCTGTACGATGAG
GATGTGTGCACCCCCGACAACCTGCAGAAGGTCCTGGAGAGTGAGGAGGGCCGCAGGGAGTACCTGGCGT
TTCCCACCAGCAAGAGCTCGGGCCAGAAGGGGCGGAAGGAGCTGCTGAAGGGCAACGGCCGGCGCATCGA
CTACATGCTGCATGCAGAGGAGGGGCTGTGCCCAGACTGGAAGGCCGAGGTGGAAGAATTCAGTTTTATC
ACCCAGCTGTCCGGCCTGACGGACCACCTGCCAGTAGCCATGCGACTGATGGTGTCTTCGGGGGAGGAGG
AGGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218441 representing NM_018667
Red=Cloning site Green=Tags(s)

MVLYTTPFPNSCLSALHCVSWALIFPCYWLVDRLAASFIPTTYEKRQRADDPCCLQLLCTALFTPIYLAL
LVASLPFAFLGFLFWSPLQSARRPYIYSRLEDKGLAGGAALLSEWKGTGPGKSFCFATANVCLLPDSLAR
VNNLFNTQARAKEIGQRIRNGAARPQIKIYIDSPTNTSISAASFSSLVSPQGGDGVARAVPGSIKRTASV
EYKGDGGRHPGDEAANGPASGDPVDSSSPEDACIVRIGGEEGGRPPEADDPVPGGQARNGAGGGPRGQTP
NHNQQDGDSGSLGSPSASRESLVKGRAGPDTSASGEPGANSKLLYKASVVKKAAARRRRHPDEAFDHEVS
AFFPANLDFLCLQEVFDKRAATKLKEQLHGYFEYILYDVGVYGCQGCCSFKCLNSGLLFASRYPIMDVAY
HCYPNKCNDDALASKGALFLKVQVGSTPQDQRIVGYIACTHLHAPQEDSAIRCGQLDLLQDWLADFRKST
SSSSAANPEELVAFDVVCGDFNFDNCSSDDKLEQQHSLFTHYRDPCRLGPGEEKPWAIGTLLDTNGLYDE
DVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFI
TQLSGLTDHLPVAMRLMVSSGEEEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018667
ORF Size 1965 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_018667.1, NM_018667.2, NM_018667.3, NP_061137
RefSeq Size 5284
RefSeq ORF 1968
Locus ID 55512
Cytogenetics 16q22.1
Domains Exo_endo_phos
Protein Families Transmembrane
Protein Pathways Sphingolipid metabolism, Metabolic pathways
MW 70.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations