GATA5 (NM_080473) Human Tagged ORF Clone

CAT#: RC218399

Reviews ()
Write a review

GATA5 (Myc-DDK-tagged)-Human GATA binding protein 5 (GATA5)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GATA5
Synonyms bB379O24.1; CHTD5; GATAS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218399 representing NM_080473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACCAGAGCCTGGCGCTGGCCGCGAGCCCCCGCCAGGCCGCCTACGCCGACTCGGGCTCCTTCCTGC
ACGCTCCGGGCGCCGGCTCTCCGATGTTTGTGCCGCCGGCGCGCGTCCCCTCGATGCTGTCCTACCTGTC
CGGGTGTGAGCCGAGCCCGCAGCCCCCCGAGCTCGCTGCGCGCCCCGGCTGGGCGCAGACAGCCACCGCG
GATTCGTCGGCCTTCGGCCCGGGCAGTCCGCACCCCCCAGCCGCGCACCCGCCCGGGGCCACCGCCTTCC
CTTTCGCGCACAGCCCCTCGGGGCCCGGCAGCGGCGGCAGCGCGGGGGGCCGAGACGGCAGTGCCTACCA
GGGCGCGCTGTTGCCTCGAGAACAGTTCGCGGCCCCGCTTGGGCGGCCGGTGGGGACCTCGTACTCCGCC
ACCTACCCGGCCTACGTGAGCCCCGACGTGGCCCAGTCCTGGACTGCCGGGCCCTTCGATGGCAGCGTCC
TGCACGGCCTCCCAGGCCGCAGGCCCACCTTCGTGTCCGACTTCTTGGAGGAGTTCCCGGGTGAGGGTCG
TGAGTGTGTCAACTGCGGGGCCCTGTCCACACCGCTGTGGCGCCGAGATGGCACCGGCCACTACCTGTGC
AATGCCTGCGGCCTCTACCACAAGATGAATGGCGTCAACCGGCCGCTCGTTCGGCCTCAGAAGCGCCTGT
CCTCGTCCCGCCGCGCCGGCCTCTGCTGCACCAACTGCCACACGACCAACACCACGCTGTGGCGGCGGAA
CTCGGAGGGGGAGCCCGTGTGCAATGCCTGCGGCCTCTACATGAAGCTGCACGGGGTGCCGCGGCCTCTG
GCTATGAAGAAAGAAAGCATCCAGACACGGAAGCGGAAGCCAAAGACCATCGCCAAGGCCAGGGGCTCCT
CAGGATCCACAAGGAATGCCTCGGCCTCCCCATCTGCTGTCGCCAGCACTGACAGCTCAGCAGCCACTTC
CAAAGCCAAGCCCAGCCTGGCGTCCCCAGTGTGCCCTGGGCCCAGCATGGCCCCCCAGGCCTCTGGCCAG
GAGGATGACTCTCTTGCCCCCGGCCACTTGGAGTTCAAGTTCGAGCCTGAGGACTTTGCCTTCCCCTCCA
CGGCCCCGAGCCCCCAGGCTGGCCTCAGGGGGGCTCTGCGCCAAGAGGCCTGGTGTGCGCTGGCCTTGGC
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218399 representing NM_080473
Red=Cloning site Green=Tags(s)

MYQSLALAASPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCEPSPQPPELAARPGWAQTATA
DSSAFGPGSPHPPAAHPPGATAFPFAHSPSGPGSGGSAGGRDGSAYQGALLPREQFAAPLGRPVGTSYSA
TYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLWRRDGTGHYLC
NACGLYHKMNGVNRPLVRPQKRLSSSRRAGLCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPL
AMKKESIQTRKRKPKTIAKARGSSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQ
EDDSLAPGHLEFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_080473
ORF Size 1191 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_080473.5
RefSeq Size 2630 bp
RefSeq ORF 1194 bp
Locus ID 140628
UniProt ID Q9BWX5
Cytogenetics 20q13.33
Protein Families Transcription Factors
MW 41.1 kDa
Gene Summary The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity. [provided by RefSeq, Jul 2008]
Other products for "GATA5"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.