GATA5 (NM_080473) Human Tagged ORF Clone

CAT#: RC218399

GATA5 (Myc-DDK-tagged)-Human GATA binding protein 5 (GATA5)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GATA5 (NM_080473) Human Tagged ORF Clone
Symbol GATA5
Synonyms bB379O24.1; GATAS
Vector pCMV6-Entry
Sequence Data
>RC218399 representing NM_080473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACCAGAGCCTGGCGCTGGCCGCGAGCCCCCGCCAGGCCGCCTACGCCGACTCGGGCTCCTTCCTGC
ACGCTCCGGGCGCCGGCTCTCCGATGTTTGTGCCGCCGGCGCGCGTCCCCTCGATGCTGTCCTACCTGTC
CGGGTGTGAGCCGAGCCCGCAGCCCCCCGAGCTCGCTGCGCGCCCCGGCTGGGCGCAGACAGCCACCGCG
GATTCGTCGGCCTTCGGCCCGGGCAGTCCGCACCCCCCAGCCGCGCACCCGCCCGGGGCCACCGCCTTCC
CTTTCGCGCACAGCCCCTCGGGGCCCGGCAGCGGCGGCAGCGCGGGGGGCCGAGACGGCAGTGCCTACCA
GGGCGCGCTGTTGCCTCGAGAACAGTTCGCGGCCCCGCTTGGGCGGCCGGTGGGGACCTCGTACTCCGCC
ACCTACCCGGCCTACGTGAGCCCCGACGTGGCCCAGTCCTGGACTGCCGGGCCCTTCGATGGCAGCGTCC
TGCACGGCCTCCCAGGCCGCAGGCCCACCTTCGTGTCCGACTTCTTGGAGGAGTTCCCGGGTGAGGGTCG
TGAGTGTGTCAACTGCGGGGCCCTGTCCACACCGCTGTGGCGCCGAGATGGCACCGGCCACTACCTGTGC
AATGCCTGCGGCCTCTACCACAAGATGAATGGCGTCAACCGGCCGCTCGTTCGGCCTCAGAAGCGCCTGT
CCTCGTCCCGCCGCGCCGGCCTCTGCTGCACCAACTGCCACACGACCAACACCACGCTGTGGCGGCGGAA
CTCGGAGGGGGAGCCCGTGTGCAATGCCTGCGGCCTCTACATGAAGCTGCACGGGGTGCCGCGGCCTCTG
GCTATGAAGAAAGAAAGCATCCAGACACGGAAGCGGAAGCCAAAGACCATCGCCAAGGCCAGGGGCTCCT
CAGGATCCACAAGGAATGCCTCGGCCTCCCCATCTGCTGTCGCCAGCACTGACAGCTCAGCAGCCACTTC
CAAAGCCAAGCCCAGCCTGGCGTCCCCAGTGTGCCCTGGGCCCAGCATGGCCCCCCAGGCCTCTGGCCAG
GAGGATGACTCTCTTGCCCCCGGCCACTTGGAGTTCAAGTTCGAGCCTGAGGACTTTGCCTTCCCCTCCA
CGGCCCCGAGCCCCCAGGCTGGCCTCAGGGGGGCTCTGCGCCAAGAGGCCTGGTGTGCGCTGGCCTTGGC
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218399 representing NM_080473
Red=Cloning site Green=Tags(s)

MYQSLALAASPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCEPSPQPPELAARPGWAQTATA
DSSAFGPGSPHPPAAHPPGATAFPFAHSPSGPGSGGSAGGRDGSAYQGALLPREQFAAPLGRPVGTSYSA
TYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLWRRDGTGHYLC
NACGLYHKMNGVNRPLVRPQKRLSSSRRAGLCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPL
AMKKESIQTRKRKPKTIAKARGSSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQ
EDDSLAPGHLEFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_080473
ORF Size 1191 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_080473.1, NM_080473.2, NM_080473.3, NM_080473.4, NP_536721
RefSeq Size 2630
RefSeq ORF 1194
Locus ID 140628
Cytogenetics 20q13.33
Protein Families Transcription Factors
MW 41.1 kDa
Gene Summary The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)