PIK3C2B (NM_002646) Human Tagged ORF Clone

CAT#: RC218354

Reviews ()
Write a review

PIK3C2B (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, class 2, beta polypeptide (PIK3C2B)



  "NM_002646" in other vectors (6)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 1,950.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PIK3C2B
Synonyms C2-PI3K
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218354 representing NM_002646
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCGACTCAGGACAATGGGGAACACTGGAAGTCCCTGGAGTCAGTGGGCATCAGCCGCAAAGAGC
TAGCGATGGCCGAAGCCCTGCAGATGGAGTATGATGCCCTGTCCCGGCTCCGGCATGACAAGGAGGAGAA
CAGAGCCAAGCAGAACGCAGACCCCTCTCTCATCAGCTGGGATGAGCCTGGGGTAGACTTTTACAGCAAG
CCAGCAGGAAGGCGGACCGACCTCAAGCTGTTACGCGGTCTCTCTGGCTCTGATCCTACCCTTAACTACA
ACTCACTCTCCCCACAGGAAGGGCCGCCCAACCACTCTACCTCCCAAGGGCCACAGCCTGGCTCAGATCC
CTGGCCCAAAGGCTCCCTGTCTGGAGACTATCTCTACATTTTTGATGGTTCAGATGGGGGAGTCTCTTCG
TCCCCAGGACCAGGGGACATAGAGGGCTCTTGCAAGAAACTATCCCCACCTCCTCTGCCTCCCCGAGCTT
CTATCTGGGATACCCCTCCCCTGCCTCCCAGAAAGGGGTCCCCCTCATCCTCCAAGATCTCCCAGCCCAG
TGACATCAACACTTTCTCTTTGGTCGAACAATTGCCGGGCAAACTGCTAGAGCATCGGATCCTAGAAGAG
GAAGAGGTGCTGGGAGGTGGGGGTCAGGGGCGCCTACTGGGGTCTGTGGACTATGATGGTATCAATGATG
CAATTACTAGGCTCAACTTGAAATCGACCTATGATGCGGAGATGTTGCGGGATGCCACCAGGGGCTGGAA
GGAGGGCCGAGGGCCGCTGGACTTCAGCAAAGACACCTCTGGAAAACCCGTGGCCAGGAGCAAGACTATG
CCCCCTCAGGTGCCCCCCCGCACCTATGCCTCCCGCTATGGCAACCGAAAGAATGCGACGCCTGACAAGA
ACCGCCGGATTTCTGCAGCCCCGGTGGGCTCCCGGCCCCACACTGTTGCCAATGGCCATGAGTTGTTTGA
GGTCTCAGAAGAGAGAGATGAGGAGGTTGCTGCATTTTGCCACATGCTGGATATCCTTCGATCTGGCTCT
GACATCCAAGACTACTTCCTCACTGGCTATGTCTGGAGTGCTGTCACCCCTAGCCCAGAGCACCTCGGGG
ATGAGGTCAACCTGAAGGTGACTGTGTTGTGTGACAGGCTTCAAGAGGCACTCACTTTCACCTGCAACTG
TTCCTCCACTGTAGACTTGCTTATCTACCAGACCCTGTGCTACACCCATGATGACCTGAGGAATGTGGAC
GTGGGTGACTTTGTGCTAAAGCCCTGCGGGCTGGAGGAGTTCCTGCAGAACAAGCATGCCTTGGGCAGTC
ATGAGTACATCCAATACTGCCGCAAGTTTGACATTGACATTCGGCTACAGCTGATGGAGCAGAAGGTTGT
GCGCAGTGACCTGGCCCGGACGGTGAATGATGACCAGAGCCCCTCCACCTTGAACTACCTCGTCCATCTC
CAAGAGAGGCCTGTCAAGCAGACCATCAGCAGGCAGGCCCTGAGTCTTCTGTTCGACACTTACCACAATG
AGGTGGATGCCTTCCTGCTGGCTGATGGAGACTTCCCACTGAAGGCTGACAGGGTGGTCCAGTCCGTCAA
GGCCATCTGCAACGCCCTGGCCGCCGTGGAAACCCCTGAGATCACCAGTGCTCTCAACCAGCTGCCCCCC
TGCCCCTCCCGCATGCAGCCTAAAATTCAGAAGGATCCCAGTGTCTTGGCTGTGAGGGAAAACCGAGAGA
AGGTCGTGGAAGCCCTGACCGCTGCCATCTTGGACCTGGTGGAGCTGTACTGCAACACATTCAACGCAGA
CTTCCAGACGGCAGTGCCCGGGAGCCGCAAGCATGACCTGGTCCAGGAGGCCTGCCATTTCGCCAGGTCC
CTGGCCTTTACTGTCTATGCCACCCACCGCATCCCCATCATCTGGGCTACCAGCTATGAAGATTTCTACC
TCTCCTGCTCCCTCAGCCATGGCGGCAAGGAGCTGTGCAGCCCCCTGCAGACCCGAAGAGCTCACTTCTC
CAAGTACCTCTTCCACCTCATCGTCTGGGACCAGCAGATCTGCTTCCCAGTGCAGGTGAACCGGCTGCCT
CGGGAGACACTGCTGTGTGCCACTCTCTATGCTCTGCCCATCCCCCCACCGGGGAGCTCCTCAGAGGCCA
ATAAGCAGCGGCGGGTGCCTGAAGCCCTGGGCTGGGTCACTACCCCACTCTTCAACTTCAGGCAGGTCCT
GACCTGTGGCCGGAAGCTTCTGGGTTTGTGGCCAGCAACACAGGAAAATCCCAGCGCCCGTTGGAGTGCA
CCTAATTTCCACCAGCCAGACAGTGTCATCCTGCAGATTGACTTCCCCACCTCGGCCTTTGACATCAAGT
TCACCAGCCCCCCTGGAGACAAGTTCAGCCCCCGCTATGAGTTTGGCAGCCTCCGGGAAGAAGACCAGCG
CAAGCTTAAAGACATCATGCAGAAAGAGTCCTTGTACTGGCTCACTGATGCTGACAAGAAGCGCCTGTGG
GAGAAGCGATATTACTGCCACTCGGAGGTGAGCTCGCTCCCCCTGGTGCTCGCCAGCGCCCCCAGCTGGG
AGTGGGCTTGCCTGCCTGACATCTATGTTCTCCTGAAGCAGTGGACCCACATGAACCACCAGGATGCCCT
GGGGCTCCTGCATGCCACCTTCCCGGACCAGGAGGTGCGTCGTATGGCTGTGCAGTGGATTGGCTCACTC
TCAGATGCTGAGCTGCTAGACTACCTGCCCCAGCTGGTACAGGCCCTGAAGTATGAATGCTACCTGGACA
GCCCGTTGGTGCGCTTCCTCCTGAAACGAGCTGTGTCTGACTTGAGAGTGACTCACTACTTCTTCTGGTT
ACTGAAGGACGGCCTCAAGGACTCTCAGTTCAGCATCCGCTACCAGTATCTGCTGGCAGCCTTACTGTGC
TGCTGTGGCAAGGGGCTGAGAGAAGAGTTTAACCGCCAGTGCTGGCTTGTCAATGCCCTGGCCAAACTGG
CCCAGCAGGTCCGGGAGGCAGCCCCATCTGCAAGGCAGGGAATCCTCCGCACGGGCCTGGAGGAGGTGAA
GCAGTTCTTTGCCCTCAATGGCTCGTGCCGCTTGCCACTCAGCCCCAGTCTGCTGGTTAAGGGAATTGTG
CCCAGGGACTGTTCCTACTTCAACTCCAATGCTGTCCCCCTCAAACTCTCCTTCCAAAATGTGGATCCCC
TGGGTGAGAACATCCGTGTCATCTTCAAGTGTGGGGACGACCTTCGCCAGGACATGCTAACGCTGCAGAT
GATTCGCATCATGAGCAAGATCTGGGTCCAGGAGGGGCTGGACATGCGCATGGTCATCTTCCGCTGCTTC
TCCACCGGCCGGGGCAGAGGGATGGTGGAGATGATCCCTAATGCTGAGACCCTGCGTAAGATCCAGGTGG
AGCATGGGGTGACCGGCTCGTTCAAGGACCGGCCCCTGGCAGACTGGCTGCAGAAACACAACCCTGGGGA
GGACGAGTATGAGAAGGCTGTGGAGAACTTTATCTACTCCTGCGCTGGCTGCTGCGTGGCCACGTACGTC
TTGGGCATCTGTGACCGACATAACGACAACATCATGCTGAAGACCACTGGTCACATGTTCCACATTGATT
TTGGCCGCTTCCTGGGCCATGCCCAGATGTTTGGCAACATCAAGCGGGACCGTGCCCCCTTTGTCTTCAC
CTCGGACATGGCGTATGTCATCAACGGGGGTGACAAGCCTTCCAGCCGCTTCCATGATTTTGTTGACCTT
TGCTGCCAAGCCTACAACCTCATTCGCAAGCACACCCACCTCTTCCTCAACCTTCTGGGCCTGATGTTGT
CCTGTGGGATCCCTGAACTCTCAGACCTGGAGGACCTCAAGTATGTGTACGATGCCCTGAGGCCTCAGGA
TACAGAGGCCAATGCCACTACCTACTTCACTAGGTTGATTGAGTCCAGCCTGGGCAGTGTAGCCACAAAG
CTCAATTTTTTCATCCATAATCTGGCTCAGATGAAGTTCACGGGCTCAGATGACCGGCTGACCCTCTCCT
TTGCCTCCCGAACACACACTCTCAAGAGCTCTGGCCGAATCAGTGATGTTTTCCTCTGCCGCCATGAGAA
GATCTTCCACCCCAACAAAGGCTATATATATGTGGTAAAGGTGATGCGAGAGAACACTCACGAGGCCACC
TACATCCAGCGGACCTTTGAGGAGTTCCAGGAATTACACAATAAGTTGCGGCTGCTCTTCCCTTCTTCCC
ACTTGCCCAGCTTCCCTAGTCGCTTCGTGATCGGCCGCTCCCGGGGAGAGGCGGTGGCCGAGCGGCGGAG
GGAGGAGCTAAACGGTTACATCTGGCACTTGATCCACGCACCCCCTGAGGTGGCCGAGTGTGATTTGGTG
TACACCTTCTTCCACCCACTGCCCCGGGATGAGAAGGCTATGGGCACCAGCCCAGCTCCTAAGTCCTCAG
ATGGCACATGGGCCCGGCCCGTCGGAAAGGTGGGAGGGGAGGTGAAGCTGTCCATCTCCTACAAAAACAA
TAAACTCTTCATCATGGTGATGCATATTCGGGGCTTGCAACTGCTCCAGGATGGAAATGACCCTGACCCC
TATGTGAAAATTTACCTCCTTCCTGACCCTCAGAAAACCACTAAGAGGAAAACCAAAGTGGCCCGGAAAA
CCTGCAATCCTACCTACAATGAGATGTTGGTATATGATGGGATCCCCAAGGGTGACCTGCAGCAGCGGGA
GCTCCAGCTGAGCGTGCTGAGTGAGCAGGGATTCTGGGAGAACGTCCTCCTCGGTGAGGTGAACATCCGC
CTGCGAGAGCTGGACCTGGCTCAGGAGAAGACCGGCTGGTTCGCCCTGGGATCTCGAAGTCATGGCACCT
TG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218354 representing NM_002646
Red=Cloning site Green=Tags(s)

MSSTQDNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSK
PAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPKGSLSGDYLYIFDGSDGGVSS
SPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSSSKISQPSDINTFSLVEQLPGKLLEHRILEE
EEVLGGGGQGRLLGSVDYDGINDAITRLNLKSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTM
PPQVPPRTYASRYGNRKNATPDKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGS
DIQDYFLTGYVWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCYTHDDLRNVD
VGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFDIDIRLQLMEQKVVRSDLARTVNDDQSPSTLNYLVHL
QERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAICNALAAVETPEITSALNQLPP
CPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELYCNTFNADFQTAVPGSRKHDLVQEACHFARS
LAFTVYATHRIPIIWATSYEDFYLSCSLSHGGKELCSPLQTRRAHFSKYLFHLIVWDQQICFPVQVNRLP
RETLLCATLYALPIPPPGSSSEANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQENPSARWSA
PNFHQPDSVILQIDFPTSAFDIKFTSPPGDKFSPRYEFGSLREEDQRKLKDIMQKESLYWLTDADKKRLW
EKRYYCHSEVSSLPLVLASAPSWEWACLPDIYVLLKQWTHMNHQDALGLLHATFPDQEVRRMAVQWIGSL
SDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKDGLKDSQFSIRYQYLLAALLC
CCGKGLREEFNRQCWLVNALAKLAQQVREAAPSARQGILRTGLEEVKQFFALNGSCRLPLSPSLLVKGIV
PRDCSYFNSNAVPLKLSFQNVDPLGENIRVIFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCF
STGRGRGMVEMIPNAETLRKIQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYV
LGICDRHNDNIMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDL
CCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLIESSLGSVATK
LNFFIHNLAQMKFTGSDDRLTLSFASRTHTLKSSGRISDVFLCRHEKIFHPNKGYIYVVKVMRENTHEAT
YIQRTFEEFQELHNKLRLLFPSSHLPSFPSRFVIGRSRGEAVAERRREELNGYIWHLIHAPPEVAECDLV
YTFFHPLPRDEKAMGTSPAPKSSDGTWARPVGKVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDP
YVKIYLLPDPQKTTKRKTKVARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVNIR
LRELDLAQEKTGWFALGSRSHGTL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002646
ORF Size 4902 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002646.4
RefSeq Size 7618 bp
RefSeq ORF 4905 bp
Locus ID 5287
UniProt ID O00750
Cytogenetics 1q32.1
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
MW 184.6 kDa
Gene Summary The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "PIK3C2B"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


PIK3C2B mouse monoclonal antibody, clone OTI3B1 (formerly 3B1)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.