JAK3 (NM_000215) Human Tagged ORF Clone

CAT#: RC217928

JAK3 (Myc-DDK-tagged)-Human Janus kinase 3 (JAK3)



  "NM_000215" in other vectors (6)

Reconstitution Protocol

USD 1,467.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "JAK3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol JAK3
Synonyms JAK-3; JAK3_HUMAN; JAKL; L-JAK; LJAK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217928 representing NM_000215
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACCTCCAAGTGAAGAGACGCCCCTGATCCCTCAGCGTTCATGCAGCCTCTTGTCCACGGAGGCTG
GTGCCCTGCATGTGCTGCTGCCCGCTCGGGGCCCCGGGCCCCCCCAGCGCCTATCTTTCTCCTTTGGGGA
CCACTTGGCTGAGGACCTGTGCGTGCAGGCTGCCAAGGCCAGCGGCATCCTGCCTGTGTACCACTCCCTC
TTTGCTCTGGCCACGGAGGACCTGTCCTGCTGGTTCCCCCCGAGCCACATCTTCTCCGTGGAGGATGCCA
GCACCCAAGTCCTGCTGTACAGGATTCGCTTTTACTTCCCCAATTGGTTTGGGCTGGAGAAGTGCCACCG
CTTCGGGCTACGCAAGGATTTGGCCAGTGCTATCCTTGACCTGCCAGTCCTGGAGCACCTCTTTGCCCAG
CACCGCAGTGACCTGGTGAGTGGGCGCCTCCCCGTGGGCCTCAGTCTCAAGGAGCAGGGTGAGTGTCTCA
GCCTGGCCGTGTTGGACCTGGCCCGGATGGCGCGAGAGCAGGCCCAGCGGCCGGGAGAGCTGCTGAAGAC
TGTCAGCTACAAGGCCTGCCTACCCCCAAGCCTGCGCGACCTGATCCAGGGCCTGAGCTTCGTGACGCGG
AGGCGTATTCGGAGGACGGTGCGCAGAGCCCTGCGCCGCGTGGCCGCCTGCCAGGCAGACCGGCACTCGC
TCATGGCCAAGTACATCATGGACCTGGAGCGGCTGGATCCAGCCGGGGCCGCCGAGACCTTCCACGTGGG
CCTCCCTGGGGCCCTTGGTGGCCACGACGGGCTGGGGCTGCTCCGCGTGGCTGGTGACGGCGGCATCGCC
TGGACCCAGGGAGAACAGGAGGTCCTCCAGCCCTTCTGCGACTTTCCAGAAATCGTAGACATTAGCATCA
AGCAGGCCCCGCGCGTTGGCCCGGCCGGAGAGCACCGCCTGGTCACTGTTACCAGGACAGACAACCAGAT
TTTAGAGGCCGAGTTCCCAGGGCTGCCCGAGGCTCTGTCGTTCGTGGCGCTCGTGGACGGCTACTTCCGG
CTGACCACGGACTCCCAGCACTTCTTCTGCAAGGAGGTGGCACCGCCGAGGCTGCTGGAGGAAGTGGCCG
AGCAGTGCCACGGCCCCATCACTCTGGACTTTGCCATCAACAAGCTCAAGACTGGGGGCTCACGTCCTGG
CTCCTATGTTCTCCGCCGCAGCCCCCAGGACTTTGACAGCTTCCTCCTCACTGTCTGTGTCCAGAACCCC
CTTGGTCCTGATTATAAGGGCTGCCTCATCCGGCGCAGCCCCACAGGAACCTTCCTTCTGGTTGGCCTCA
GCCGACCCCACAGCAGTCTTCGAGAGCTCCTGGCAACCTGCTGGGATGGGGGGCTGCACGTAGATGGGGT
GGCAGTGACCCTCACTTCCTGCTGTATCCCCAGACCCAAAGAAAAGTCCAACCTGATCGTGGTCCAGAGA
GGTCACAGCCCACCCACATCATCCTTGGTTCAGCCCCAATCCCAATACCAGCTGAGTCAGATGACATTTC
ACAAGATCCCTGCTGACAGCCTGGAGTGGCATGAGAACCTGGGCCATGGGTCCTTCACCAAGATTTACCG
GGGCTGTCGCCATGAGGTGGTGGATGGGGAGGCCCGAAAGACAGAGGTGCTGCTGAAGGTCATGGATGCC
AAGCACAAGAACTGCATGGAGTCATTCCTGGAAGCAGCGAGCTTGATGAGCCAAGTGTCGTACCGGCATC
TCGTGCTGCTCCACGGCGTGTGCATGGCTGGAGACAGCACCATGGTGCAGGAATTTGTACACCTGGGGGC
CATAGACATGTATCTGCGAAAACGTGGCCACCTGGTGCCAGCCAGCTGGAAGCTGCAGGTGGTCAAACAG
CTGGCCTACGCCCTCAACTATCTGGAGGACAAAGGCCTGCCCCATGGCAATGTCTCTGCCCGGAAGGTGC
TCCTGGCTCGGGAGGGGGCTGATGGGAGCCCGCCCTTCATCAAGCTGAGTGACCCTGGGGTCAGCCCCGC
TGTGTTAAGCCTGGAGATGCTCACCGACAGGATCCCCTGGGTGGCCCCCGAGTGTCTCCGGGAGGCGCAG
ACACTTAGCTTGGAAGCTGACAAGTGGGGCTTCGGCGCCACGGTCTGGGAAGTGTTTAGTGGCGTCACCA
TGCCCATCAGTGCCCTGGATCCTGCTAAGAAACTCCAATTTTATGAGGACCGGCAGCAGCTGCCGGCCCC
CAAGTGGACAGAGCTGGCCCTGCTGATTCAACAGTGCATGGCCTATGAGCCGGTCCAGAGGCCCTCCTTC
CGAGCCGTCATTCGTGACCTCAATAGCCTCATCTCTTCAGACTATGAGCTCCTCTCAGACCCCACACCTG
GTGCCCTGGCACCTCGTGATGGGCTGTGGAATGGTGCCCAGCTCTATGCCTGCCAAGACCCCACGATCTT
CGAGGAGAGACACCTCAAGTACATCTCACAGCTGGGCAAGGGCAACTTTGGCAGCGTGGAGCTGTGCCGC
TATGACCCGCTAGGCGACAATACAGGTGCCCTGGTGGCCGTGAAACAGCTGCAGCACAGCGGGCCAGACC
AGCAGAGGGACTTTCAGCGGGAGATTCAGATCCTCAAAGCACTGCACAGTGATTTCATTGTCAAGTATCG
TGGTGTCAGCTATGGCCCGGGCCGCCAGAGCCTGCGGCTGGTCATGGAGTACCTGCCCAGCGGCTGCTTG
CGCGACTTCCTGCAGCGGCACCGCGCGCGCCTCGATGCCAGCCGCCTCCTTCTCTATTCCTCGCAGATCT
GCAAGGGCATGGAGTACCTGGGCTCCCGCCGCTGCGTGCACCGCGACCTGGCCGCCCGAAACATCCTCGT
GGAGAGCGAGGCACACGTCAAGATCGCTGACTTCGGCCTAGCTAAGCTGCTGCCGCTTGACAAAGACTAC
TACGTGGTCCGCGAGCCAGGCCAGAGCCCCATTTTCTGGTATGCCCCCGAATCCCTCTCGGACAACATCT
TCTCTCGCCAGTCAGACGTCTGGAGCTTCGGGGTCGTCCTGTACGAGCTCTTCACCTACTGCGACAAAAG
CTGCAGCCCCTCGGCCGAGTTCCTGCGGATGATGGGATGTGAGCGGGATGTCCCCGCCCTCTGCCGCCTC
TTGGAACTGCTGGAGGAGGGCCAGAGGCTGCCGGCGCCTCCTGCCTGCCCTGCTGAGGTTCACGAGCTCA
TGAAGCTGTGCTGGGCCCCTAGCCCACAGGACCGGCCATCATTCAGCGCCCTGGGCCCCCAGCTGGACAT
GCTGTGGAGCGGAAGCCGGGGGTGTGAGACTCATGCCTTCACTGCTCACCCAGAGGGCAAACACCACTCC
CTGTCCTTTTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217928 representing NM_000215
Red=Cloning site Green=Tags(s)

MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKASGILPVYHSL
FALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGLRKDLASAILDLPVLEHLFAQ
HRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQRPGELLKTVSYKACLPPSLRDLIQGLSFVTR
RRIRRTVRRALRRVAACQADRHSLMAKYIMDLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIA
WTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFR
LTTDSQHFFCKEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPKEKSNLIVVQR
GHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCRHEVVDGEARKTEVLLKVMDA
KHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQEFVHLGAIDMYLRKRGHLVPASWKLQVVKQ
LAYALNYLEDKGLPHGNVSARKVLLAREGADGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQ
TLSLEADKWGFGATVWEVFSGVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSF
RAVIRDLNSLISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCL
RDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDY
YVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRL
LELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHS
LSFS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000215
ORF Size 3372 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000215.4
RefSeq Size 4025 bp
RefSeq ORF 3375 bp
Locus ID 3718
UniProt ID P52333
Cytogenetics 19p13.11
Domains B41, pkinase, SH2, TyrKc, S_TKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Chemokine signaling pathway, Jak-STAT signaling pathway, Primary immunodeficiency
MW 124.9 kDa
Gene Summary The protein encoded by this gene is a member of the Janus kinase (JAK) family of tyrosine kinases involved in cytokine receptor-mediated intracellular signal transduction. It is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in this gene are associated with autosomal SCID (severe combined immunodeficiency disease). [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.