ADAMTS9 (NM_182920) Human Tagged ORF Clone

CAT#: RC217581

Reviews ()
Write a review

ADAMTS9 (Myc-DDK-tagged)-Human ADAM metallopeptidase with thrombospondin type 1 motif, 9 (ADAMTS9)



  "NM_182920" in other vectors (3)

USD 1,490.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ADAMTS9 (NM_182920) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ADAMTS9
Synonyms FLJ42955; KIAA1312
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC217581 representing NM_182920
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTTTGTATCCTGGGCCACACTGCTAACGCTCCTGGTGCGGGACCTGGCCGAGATGGGGAGCCCAG
ACGCCGCGGCGGCCGTGCGCAAGGACAGGCTGCACCCGAGGCAAGTGAAATTATTAGAGACCCTGAGCGA
ATACGAAATCGTGTCTCCCATCCGAGTGAACGCTCTCGGAGAACCCTTTCCCACGAACGTCCACTTCAAA
AGAACGCGACGGAGCATTAACTCTGCCACTGACCCCTGGCCTGCCTTCGCCTCCTCCTCTTCCTCCTCTA
CCTCCTCCCAGGCGCATTACCGCCTCTCTGCCTTCGGCCAGCAGTTTCTATTTAATCTCACCGCCAATGC
CGGATTTATCGCTCCACTGTTCACTGTCACCCTCCTCGGGACGCCCGGGGTGAATCAGACCAAGTTTTAT
TCCGAAGAGGAAGCGGAACTCAAGCACTGTTTCTACAAAGGCTATGTCAATACCAACTCCGAGCACACGG
CCGTCATCAGCCTCTGCTCAGGAATGCTGGGCACATTCCGGTCTCATGATGGGGATTATTTTATTGAACC
ACTACAGTCTATGGATGAACAAGAAGATGAAGAGGAACAAAACAAACCCCACATCATTTATAGGCGCAGC
GCCCCCCAGAGAGAGCCCTCAACAGGAAGGCATGCATGTGACACCTCAGAACACAAAAATAGGCACAGTA
AAGACAAGAAGAAAACCAGAGCAAGAAAATGGGGAGAAAGGATTAACCTGGCTGGTGACGTAGCAGCATT
AAACAGCGGCTTAGCAACAGAGGCATTTTCTGCTTATGGTAATAAGACGGACAACACAAGAGAAAAGAGG
ACCCACAGAAGGACAAAACGTTTTTTATCCTATCCACGGTTTGTAGAAGTCTTGGTGGTGGCAGACAACA
GAATGGTTTCATACCATGGAGAAAACCTTCAACACTATATTTTAACTTTAATGTCAATTGTAGCCTCTAT
CTATAAAGACCCAAGTATTGGAAATTTAATTAATATTGTTATTGTGAACTTAATTGTGATTCATAATGAA
CAGGATGGGCCTTCCATATCTTTTAATGCTCAGACAACATTAAAAAACTTTTGCCAGTGGCAGCATTCGA
AGAACAGTCCAGGTGGAATCCATCATGATACTGCTGTTCTCTTAACAAGACAGGATATCTGCAGAGCTCA
CGACAAATGTGATACCTTAGGCCTGGCTGAACTGGGAACCATTTGTGATCCCTATAGAAGCTGTTCTATT
AGTGAAGATAGTGGATTGAGTACAGCTTTTACGATCGCCCATGAGCTGGGCCATGTGTTTAACATGCCTC
ATGATGACAACAACAAATGTAAAGAAGAAGGAGTTAAGAGTCCCCAGCATGTCATGGCTCCAACACTGAA
CTTCTACACCAACCCCTGGATGTGGTCAAAGTGTAGTCGAAAATATATCACTGAGTTTTTAGACACTGGT
TATGGCGAGTGTTTGCTTAACGAACCTGAATCCAGACCCTACCCTTTGCCTGTCCAACTGCCAGGCATCC
TTTACAACGTGAATAAACAATGTGAATTGATTTTTGGACCAGGTTCTCAGGTGTGCCCATATATGATGCA
GTGCAGACGGCTCTGGTGCAATAACGTCAATGGAGTACACAAAGGCTGCCGGACTCAGCACACACCCTGG
GCCGATGGGACGGAGTGCGAGCCTGGAAAGCACTGCAAGTATGGATTTTGTGTTCCCAAAGAAATGGATG
TCCCCGTGACAGATGGATCCTGGGGAAGTTGGAGTCCCTTTGGAACCTGCTCCAGAACATGTGGAGGGGG
CATCAAAACAGCCATTCGAGAGTGCAACAGACCAGAACCAAAAAATGGTGGAAAATACTGTGTAGGACGT
AGAATGAAATTTAAGTCCTGCAACACGGAGCCATGTCTCAAGCAGAAGCGAGACTTCCGAGATGAACAGT
GTGCTCACTTTGACGGGAAGCATTTTAACATCAACGGTCTGCTTCCCAATGTGCGCTGGGTCCCTAAATA
CAGTGGAATTCTGATGAAGGACCGGTGCAAGTTGTTCTGCAGAGTGGCAGGGAACACAGCCTACTATCAG
CTTCGAGACAGAGTGATAGATGGAACTCCTTGTGGCCAGGACACAAATGATATCTGTGTCCAGGGCCTTT
GCCGGCAAGCTGGATGCGATCATGTTTTAAACTCAAAAGCCCGGAGAGATAAATGTGGGGTTTGTGGTGG
CGATAATTCTTCATGCAAAACAGTGGCAGGAACATTTAATACAGTACATTATGGTTACAATACTGTGGTC
CGAATTCCAGCTGGTGCTACCAATATTGATGTGCGGCAGCACAGTTTCTCAGGGGAAACAGACGATGACA
ACTACTTAGCTTTATCAAGCAGTAAAGGTGAATTCTTGCTAAATGGAAACTTTGTTGTCACAATGGCCAA
AAGGGAAATTCGCATTGGGAATGCTGTGGTAGAGTACAGTGGGTCCGAGACTGCCGTAGAAAGAATTAAC
TCAACAGATCGCATTGAGCAAGAACTTTTGCTTCAGGTTTTGTCGGTGGGAAAGTTGTACAACCCCGATG
TACGCTATTCTTTCAATATTCCAATTGAAGATAAACCTCAGCAGTTTTACTGGAACAGTCATGGGCCATG
GCAAGCATGCAGTAAACCCTGCCAAGGGGAACGGAAACGAAAACTTGTTTGCACCAGGGAATCTGATCAG
CTTACTGTTTCTGATCAAAGATGCGATCGGCTGCCCCAGCCTGGACACATTACTGAACCCTGTGGTACAG
ACTGTGACCTGAGGTGGCATGTTGCCAGCAGGAGTGAATGTAGTGCCCAGTGTGGCTTGGGTTACCGCAC
ATTGGACATCTACTGTGCCAAATATAGCAGGCTGGATGGGAAGACTGAGAAGGTTGATGATGGTTTTTGC
AGCAGCCATCCCAAACCAAGCAACCGTGAAAAATGCTCAGGGGAATGTAACACGGGTGGCTGGCGCTATT
CTGCCTGGACTGAATGTTCAAAAAGCTGTGACGGTGGGACCCAGAGGAGAAGGGCTATTTGTGTCAATAC
CCGAAATGATGTACTGGATGACAGCAAATGCACACATCAAGAGAAAGTTACCATTCAGAGGTGCAGTGAG
TTCCCTTGTCCACAGTGGAAATCTGGAGACTGGTCAGAGTGCTTGGTCACCTGTGGAAAAGGGCATAAGC
ACCGCCAGGTCTGGTGTCAGTTTGGTGAAGATCGATTAAATGATAGAATGTGTGACCCTGAGACCAAGCC
AACATCTATGCAGACTTGTCAGCAGCCGGAATGTGCATCCTGGCAGGCGGGTCCCTGGGGACAGTGCAGT
GTCACTTGTGGACAGGGATACCAGCTAAGAGCAGTGAAATGCATCATTGGGACTTATATGTCAGTGGTAG
ATGACAATGACTGTAATGCAGCAACTAGACCAACTGATACCCAGGACTGTGAATTACCATCATGTCATCC
TCCCCCAGCTGCCCCGGAAACGAGGAGAAGCACATACAGTGCACCAAGAACCCAGTGGCGATTTGGGTCT
TGGACCCCATGCTCAGCCACTTGTGGGAAAGGTACCCGGATGAGATACGTCAGCTGCCGAGATGAGAATG
GCTCTGTGGCTGACGAGAGTGCCTGTGCTACCCTGCCTAGACCAGTGGCAAAGGAAGAATGTTCTGTGAC
ACCCTGTGGGCAATGGAAGGCCTTGGACTGGAGCTCTTGCTCTGTGACCTGTGGGCAAGGTAGGGCAACC
CGGCAAGTGATGTGTGTCAACTACAGTGACCACGTGATCGATCGGAGTGAGTGTGACCAGGATTATATCC
CAGAAACTGACCAGGACTGTTCCATGTCACCATGCCCTCAAAGGACCCCAGACAGTGGCTTAGCTCAGCA
CCCCTTCCAAAATGAGGACTATCGTCCCCGGAGCGCCAGCCCCAGCCGCACCCATGTGCTCGGTGGAAAC
CAGTGGAGAACTGGCCCCTGGGGAGCATGTTCCAGTACCTGTGCTGGCGGATCCCAGCGGCGTGTTGTTG
TATGTCAGGATGAAAATGGATACACCGCAAACGACTGTGTGGAGAGAATAAAACCTGATGAGCAAAGAGC
CTGTGAATCCGGCCCTTGTCCTCAGTGGGCTTATGGCAACTGGGGAGAGTGCACTAAGCTGTGTGGTGGA
GGCATAAGAACAAGACTGGTGGTCTGTCAGCGGTCCAACGGTGAACGGTTTCCAGATTTGAGCTGTGAAA
TTCTTGATAAACCTCCCGATCGTGAGCAGTGTAACACACATGCTTGTCCACACGACGCTGCATGGAGTAC
TGGCCCTTGGAGCTCGTGTTCTGTCTCTTGTGGTCGAGGGCATAAACAACGAAATGTTTACTGCATGGCA
AAAGATGGAAGCCATTTAGAAAGTGATTACTGTAAGCACCTGGCTAAGCCACATGGGCACAGAAAGTGCC
GAGGAGGAAGATGCCCCAAATGGAAAGCTGGCGCTTGGAGTCAGTGCTCTGTGTCCTGTGGCCGAGGCGT
ACAGCAGAGGCATGTGGGCTGTCAGATCGGAACACACAAAATAGCCAGAGAGACCGAGTGCAACCCATAC
ACCAGACCGGAGTCGGAACGCGACTGCCAAGGCCCACGGTGTCCCCTCTACACTTGGAGGGCAGAGGAAT
GGCAAGAATGCACCAAGACCTGCGGCGAAGGCTCCAGGTACCGCAAGGTGGTGTGTGTGGATGACAACAA
AAACGAGGTGCATGGGGCACGCTGTGACGTGAGCAAGCGGCCGGTGGACCGTGAAAGCTGTAGTTTGCAA
CCCTGCGAGTATGTCTGGATCACAGGAGAATGGTCAGAGTGCTCAGTGACCTGTGGAAAAGGCTACAAAC
AAAGGCTTGTCTCGTGCAGCGAGATTTACACCGGGAAGGAGAATTATGAATACAGCTACCAAACCACCAT
CAACTGCCCAGGCACGCAGCCCCCCAGTGTTCACCCCTGTTACCTGAGGGACTGCCCTGTCTCGGCCACC
TGGAGAGTTGGCAACTGGGGGAGCTGCTCAGTGTCTTGTGGTGTTGGAGTGATGCAGAGATCTGTGCAAT
GTTTAACCAATGAGGACCAACCCAGCCACTTATGCCACACTGATCTGAAGCCAGAAGAACGAAAAACCTG
CCGTAATGTCTATAACTGTGAGTTACCCCAGAATTGCAAGGAGGTAAAAAGACTTAAAGGTGCCAGTGAA
GATGGTGAATATTTCCTGATGATTAGAGGAAAGCTTCTGAAGATATTCTGTGCGGGGATGCACTCTGACC
ACCCCAAAGAGTACGTGACACTGGTGCATGGAGACTCTGAGAATTTCTCCGAGGTTTATGGGCACAGGTT
ACACAACCCAACAGAATGTCCCTATAACGGGAGCCGGCGCGATGACTGCCAATGTCGGAAGGATTACACG
GCCGCTGGGTTTTCCAGTTTTCAGAAAATCAGAATAGACCTGACCAGCATGCAGATAATCACCACTGACT
TACAGTTTGCAAGGACAAGCGAAGGACATCCCGTCCCTTTTGCCACAGCCGGGGATTGCTACAGCGCTGC
CAAGTGCCCACAGGGTCGTTTTAGCATCAACCTTTATGGAACCGGCTTGTCTTTAACTGAATCTGCCAGA
TGGATATCACAAGGGAATTATGCTGTCTCTGACATCAAGAAGTCGCCGGATGGTACCCGAGTCGTAGGGA
AATGCGGTGGTTACTGTGGAAAATGCACTCCATCCTCTGGTACTGGCCTGGAGGTGCGAGTTTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217581 representing NM_182920
Red=Cloning site Green=Tags(s)

MQFVSWATLLTLLVRDLAEMGSPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALGEPFPTNVHFK
RTRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFIAPLFTVTLLGTPGVNQTKFY
SEEEAELKHCFYKGYVNTNSEHTAVISLCSGMLGTFRSHDGDYFIEPLQSMDEQEDEEEQNKPHIIYRRS
APQREPSTGRHACDTSEHKNRHSKDKKKTRARKWGERINLAGDVAALNSGLATEAFSAYGNKTDNTREKR
THRRTKRFLSYPRFVEVLVVADNRMVSYHGENLQHYILTLMSIVASIYKDPSIGNLINIVIVNLIVIHNE
QDGPSISFNAQTTLKNFCQWQHSKNSPGGIHHDTAVLLTRQDICRAHDKCDTLGLAELGTICDPYRSCSI
SEDSGLSTAFTIAHELGHVFNMPHDDNNKCKEEGVKSPQHVMAPTLNFYTNPWMWSKCSRKYITEFLDTG
YGECLLNEPESRPYPLPVQLPGILYNVNKQCELIFGPGSQVCPYMMQCRRLWCNNVNGVHKGCRTQHTPW
ADGTECEPGKHCKYGFCVPKEMDVPVTDGSWGSWSPFGTCSRTCGGGIKTAIRECNRPEPKNGGKYCVGR
RMKFKSCNTEPCLKQKRDFRDEQCAHFDGKHFNINGLLPNVRWVPKYSGILMKDRCKLFCRVAGNTAYYQ
LRDRVIDGTPCGQDTNDICVQGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNTVV
RIPAGATNIDVRQHSFSGETDDDNYLALSSSKGEFLLNGNFVVTMAKREIRIGNAVVEYSGSETAVERIN
STDRIEQELLLQVLSVGKLYNPDVRYSFNIPIEDKPQQFYWNSHGPWQACSKPCQGERKRKLVCTRESDQ
LTVSDQRCDRLPQPGHITEPCGTDCDLRWHVASRSECSAQCGLGYRTLDIYCAKYSRLDGKTEKVDDGFC
SSHPKPSNREKCSGECNTGGWRYSAWTECSKSCDGGTQRRRAICVNTRNDVLDDSKCTHQEKVTIQRCSE
FPCPQWKSGDWSECLVTCGKGHKHRQVWCQFGEDRLNDRMCDPETKPTSMQTCQQPECASWQAGPWGQCS
VTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGS
WTPCSATCGKGTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQWKALDWSSCSVTCGQGRAT
RQVMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGN
QWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACESGPCPQWAYGNWGECTKLCGG
GIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTHACPHDAAWSTGPWSSCSVSCGRGHKQRNVYCMA
KDGSHLESDYCKHLAKPHGHRKCRGGRCPKWKAGAWSQCSVSCGRGVQQRHVGCQIGTHKIARETECNPY
TRPESERDCQGPRCPLYTWRAEEWQECTKTCGEGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQ
PCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDCPVSAT
WRVGNWGSCSVSCGVGVMQRSVQCLTNEDQPSHLCHTDLKPEERKTCRNVYNCELPQNCKEVKRLKGASE
DGEYFLMIRGKLLKIFCAGMHSDHPKEYVTLVHGDSENFSEVYGHRLHNPTECPYNGSRRDDCQCRKDYT
AAGFSSFQKIRIDLTSMQIITTDLQFARTSEGHPVPFATAGDCYSAAKCPQGRFSINLYGTGLSLTESAR
WISQGNYAVSDIKKSPDGTRVVGKCGGYCGKCTPSSGTGLEVRVL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_182920
ORF Size 5805 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_182920.1, NP_891550.1
RefSeq Size 7335 bp
RefSeq ORF 5808 bp
Locus ID 56999
Cytogenetics 3p14.1
Protein Families Druggable Genome
MW 214.4 kDa
Gene Summary This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. Members of the ADAMTS family have been implicated in the cleavage of proteoglycans, the control of organ shape during development, and the inhibition of angiogenesis. This gene is localized to chromosome 3p14.3-p14.2, an area known to be lost in hereditary renal tumors. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Jan 2016]

Citations (2)

Other Versions

Other products for "ADAMTS9"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools