GNG4 (NM_001098722) Human Tagged ORF Clone

CAT#: RC217368

GNG4 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma 4 (GNG4), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name GNG4 (NM_001098722) Human Tagged ORF Clone
Symbol GNG4
Synonyms DKFZp547K1018; FLJ23803; FLJ34187
Vector pCMV6-Entry
Sequence Data
>RC217368 representing NM_001098722
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGAGGGCATGTCTAATAACAGCACCACTAGCATCTCCCAAGCCAGGAAAGCTGTGGAGCAGCTAA
AGATGGAAGCCTGTATGGACAGGGTCAAGGTCTCCCAGGCAGCTGCGGACCTCCTGGCCTACTGTGAAGC
TCACGTGCGGGAAGATCCTCTCATCATTCCAGTGCCTGCATCAGAAAACCCCTTTCGCGAGAAGAAGTTC
TTTTGTACCATTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217368 representing NM_001098722
Red=Cloning site Green=Tags(s)

MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKF
FCTIL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001098722
ORF Size 225 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001098722.1, NP_001092192
RefSeq Size 5123
RefSeq ORF 228
Locus ID 2786
Cytogenetics 1q42.3
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway
MW 8.2 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)