GNG4 (NM_001098722) Human Tagged ORF Clone

CAT#: RC217368

Reviews ()
Write a review

GNG4 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma 4 (GNG4), transcript variant 1


 Cited in 1 publication.

  "NM_001098722" in other vectors (4)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name GNG4 (NM_001098722) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GNG4
Synonyms DKFZp547K1018; FLJ23803; FLJ34187
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC217368 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGAGGGCATGTCTAATAACAGCACCACTAGCATCTCCCAAGCCAGGAAAGCTGTGGAGCAGCTAA
AGATGGAAGCCTGTATGGACAGGGTCAAGGTCTCCCAGGCAGCTGCGGACCTCCTGGCCTACTGTGAAGC
TCACGTGCGGGAAGATCCTCTCATCATTCCAGTGCCTGCATCAGAAAACCCCTTTCGCGAGAAGAAGTTC
TTTTGTACCATTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217368 protein sequence
Red=Cloning site Green=Tags(s)

MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKF
FCTIL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001098722
ORF Size 225 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001098722.1, NP_001092192.1
RefSeq Size 5123
RefSeq ORF 228
Locus ID 2786
Cytogenetics 1q42.3
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway
MW 8.4 kDa

Citations (1)

Other Versions

Other products for "GNG4"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-GNG4 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools