DTX4 (NM_015177) Human Tagged ORF Clone

CAT#: RC217321

DTX4 (Myc-DDK-tagged)-Human deltex homolog 4 (Drosophila) (DTX4)

 Cited in 1 publication.

  View "NM_015177" in other vectors (10)

USD 810.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name DTX4 (NM_015177) Human Tagged ORF Clone
Symbol DTX4
Synonyms RNF155
Vector pCMV6-Entry
Sequence Data
>RC217321 representing NM_015177
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCCTGGCCTCGGCCGTGGTGGTCTGGGAATGGCTGAACGAGCACGGCCGCTGGCGTCCCTACAGCC
CAGCGGTGAGCCACCACATCGAGGCGGTGGTCCGCGCCGGCCCCCGCGCGGGGGGCAGCGTGGTGCTGGG
CCAGGTGGACAGCCGTCTCGCGCCCTACATCATCGACCTGCAGTCCATGAACCAGTTCCGCCAAGACACG
GGAACTCTCCGCCCAGTTCGCCGCAACTACTACGACCCCTCCTCGGCCCCTGGGAAGGGCGTGGTGTGGG
AGTGGGAGAACGACAATGGCTCCTGGACGCCCTACGACATGGAAGTGGGCATCACCATCCAGCATGCCTA
TGAGAAGCAGCACCCCTGGATCGACCTCACTTCCATTGGCTTTAGCTACGTAATTGACTTCAACACCATG
GGCCAGATCAACCGTCAGACCCAGCGCCAACGCCGCGTCCGCCGGCGCCTCGACCTCATCTACCCCATGG
TCACAGGGACCTTGCCTAAGGCTCAGTCCTGGCCAGTCAGCCCTGGGCCAGCCACCTCGCCCCCCATGTC
CCCCTGCTCCTGTCCCCAGTGTGTCTTGGTGATGAGTGTTAAGGCAGCCGTGGTCAATGGCAGCACTGGG
CCCCTACAGCTGCCAGTGACCCGCAAGAACATGCCGCCTCCTGGAGTGGTCAAGCTACCCCCACTGCCAG
GCTCTGGGGCCAAGCCACTGGACAGCACAGGCACCATTCGAGGCCCACTGAAGACCGCCCCATCGCAGGT
GATCCGGAGACAAGCCTCCAGCATGCCCACTGGGACAACCATGGGCTCTCCTGCCAGTCCCCCAGGACCC
AACAGCAAGACCGGAAGGGTGGCCCTGGCCACCTTGAATCGTACCAACCTGCAGCGACTGGCCATTGCCC
AGTCCCGGGTGCTGATCGCCTCTGGGGTCCCCACAGTCCCAGTGAAGAACCTAAATGGGTCCAGTCCTGT
CAACCCTGCCTTGGCAGGAATCACTGGGATCCTCATGAGTGCAGCGGGGCTGCCTGTGTGTCTCACCAGG
CCACCAAAGCTGGTCCTACACCCACCCCCCGTCAGCAAGAGTGAAATAAAATCCATCCCAGGGGTTTCCA
ACACAAGCCGCAAGACCACCAAAAAACAAGCCAAGAAAGGTAAAACCCCAGAGGAAGTGCTAAAAAAATA
TCTACAGAAAGTCCGGCACCCACCAGATGAGGACTGCACCATCTGTATGGAACGCCTCACGGCCCCCTCA
GGCTACAAGGGCCCGCAGCCTACGGTAAAACCTGACCTGGTAGGGAAGCTGTCCAGATGCGGCCACGTCT
ACCACATCTACTGCTTGGTTGCCATGTACAACAATGGGAACAAGGATGGAAGTTTGCAGTGTCCAACCTG
CAAGACCATTTATGGGGTGAAGACAGGCACCCAACCTCCAGGGAAGATGGAGTACCACCTCATCCCCCAC
TCCTTGCCTGGCCACCCAGACTGCAAAACCATCCGGATCATCTACAGCATCCCCCCCGGCATTCAGGGAC
CGGAACACCCGAATCCTGGGAAGAGTTTCAGCGCCCGAGGCTTCCCACGACACTGTTACCTTCCGGACAG
CGAGAAAGGGAGAAAAGTTCTGAAGCTGCTGCTCGTGGCCTGGGATCGCCGCCTCATTTTTGCCATTGGC
ACCTCCAGCACCACAGGCGAGTCAGACACCGTCATCTGGAATGAGGTCCACCACAAGACAGAGTTTGGCT
CTAATCTCACTGGCCATGGCTACCCAGATGCCAATTACCTGGATAATGTGCTGGCTGAACTGGCTGCCCA
GGGCATCTCTGAGGACAGCACTGCCCAGGAGAAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217321 representing NM_015177
Red=Cloning site Green=Tags(s)

MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDT
GTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQHPWIDLTSIGFSYVIDFNTM
GQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTG
PLQLPVTRKNMPPPGVVKLPPLPGSGAKPLDSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGP
NSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTR
PPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPS
GYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPH
SLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIG
TSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015177
ORF Size 1857 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015177.1, NP_055992
RefSeq Size 5795
RefSeq ORF 1860
Locus ID 23220
Cytogenetics 11q12.1
Protein Families Druggable Genome
Protein Pathways Notch signaling pathway
MW 67.1 kDa

Citations (1)

Other Versions

Other products for "DTX4"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies