Transmembrane protein 30A (TMEM30A) (NM_018247) Human Tagged ORF Clone

CAT#: RC217257

TMEM30A (Myc-DDK-tagged)-Human transmembrane protein 30A (TMEM30A), transcript variant 1

Product Images

Circular map for RC217257

• 

  Western blot validation of overexpression lysate (Cat# LY413188) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC217257 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified TMEM30A protein (Cat# TP317257). The protein was produced from HEK293T cells transfected with TMEM30A cDNA clone (Cat# RC217257) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Transmembrane protein 30A
• Synonyms: C6orf67; CDC50A
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC217257 representing NM_018247
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGATGAACTATAACGCGAAGGATGAAGTGGACGGTGGGCCCCCGTGTGCTCCGGGGGGCACCGCGA
  AGACTCGGAGACCGGATAACACGGCCTTCAAACAGCAACGGCTGCCAGCTTGGCAGCCCATCCTTACGGC
  TGGCACGGTGCTACCTATTTTCTTCATCATCGGTCTCATCTTCATTCCCATCGGCATTGGCATTTTTGTC
  ACCTCCAACAACATCCGCGAGATCGAGATTGATTATACCGGAACAGAGCCTTCCAGTCCCTGTAATAAAT
  GTTTATCTCCGGATGTGACACCTTGCTTTTGTACCATTAACTTCACACTGGAAAAGTCATTTGAGGGCAA
  CGTGTTTATGTATTATGGACTGTCTAATTTCTATCAAAACCATCGTCGTTACGTGAAATCTCGAGATGAT
  AGTCAACTAAATGGAGATTCTAGTGCTTTGCTTAATCCCAGTAAGGAATGTGAACCTTATCGAAGAAATG
  AAGACAAACCAATTGCTCCTTGTGGAGCTATTGCCAACAGCATGTTTAATGATACATTAGAATTGTTTCT
  CATTGGCAATGATTCTTATCCTATACCTATCGCTTTGAAAAAGAAAGGTATTGCTTGGTGGACAGATAAA
  AATGTGAAATTCAGAAATCCCCCTGGAGGAGACAACCTGGAAGAACGATTTAAAGGTACAACAAAGCCTG
  TGAACTGGCTTAAACCAGTTTACATGCTGGATTCTGACCCAGATAATAATGGATTCATAAATGAGGATTT
  TATTGTTTGGATGCGTACTGCAGCATTACCTACTTTTCGCAAGTTGTATCGTCTTATAGAAAGGAAAAGT
  GATTTACATCCAACATTACCAGCTGGCCGATACTCTTTGAATGTCACATACAATTACCCTGTACATTATT
  TTGATGGACGAAAACGGATGATCTTGAGCACTATTTCATGGATGGGAGGAAAAAATCCATTTTTGGGGAT
  TGCTTACATCGCTGTTGGATCCATCTCCTTCCTTCTGGGAGTTGTACTGCTAGTAATTAATCATAAATAT
  AGAAACAGTAGTAATACAGCTGACATTACCATT
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC217257 representing NM_018247
  Red=Cloning site Green=Tags(s)
  
  MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFV
  TSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDD
  SQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDK
  NVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKS
  DLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKY
  RNSSNTADITI
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_018247
• ORF Size: 1083 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_018247.4
• RefSeq Size: 4410 bp
• RefSeq ORF: 1086 bp
• Locus ID: 55754
• UniProt ID: Q9NV96
• Cytogenetics: 6q14.1
• Domains: CDC50
• Protein Families: Druggable Genome, Transmembrane
• MW: 40.5 kDa
• Gene Summary: Accessory component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules. The beta subunit may assist in binding of the phospholipid substrate. Required for the proper folding, assembly and ER to Golgi exit of the ATP8A2:TMEM30A flippase complex. ATP8A2:TMEM30A may be involved in regulation of neurite outgrowth, and, reconstituted to liposomes, predomiminantly transports phosphatidylserine (PS) and to a lesser extent phosphatidylethanolamine (PE). The ATP8A1:TMEM30A flippase complex seems to play a role in regulation of cell migration probably involving flippase-mediated translocation of phosphatidylethanolamine (PE) at the plasma membrane. Required for the formation of the ATP8A2, ATP8B1 and ATP8B2 P-type ATPAse intermediate phosphoenzymes. Involved in uptake of platelet-activating factor (PAF), synthetic drug alkylphospholipid edelfosine, and, probably in association with ATP8B1, of perifosine. Also mediate the export of alpha subunits ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B and ATP11C from the ER to other membrane localizations.[UniProtKB/Swiss-Prot Function]