BPTF(BPTF) (NM_182641) Human Tagged ORF Clone

CAT#: RC217011

BPTF (Myc-DDK-tagged)-Human bromodomain PHD finger transcription factor (BPTF), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BPTF(BPTF) (NM_182641) Human Tagged ORF Clone
Symbol BPTF
Synonyms FAC1; FALZ; NURF301
Vector pCMV6-Entry
Sequence Data
>RC217011 representing NM_182641
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGGCCGGCGGGGCAGGCCGCCCAAGCAGCCCGCGGCTCCCGCTGCGGAGCGCTGCGCCCCGGCCC
CGCCGCCACCGCCGCCGCCGCCCACGTCCGGACCCATCGGGGGGCTCCGCTCGCGGCACCGCGGCAGCAG
CCGGGGCAGGTGGGCCGCCGCCCAGGCTGAGGTGGCGCCCAAGACGCGGCTGAGCTCGCCCAGGGGGGGC
AGCAGTAGCCGGAGGAAGCCGCCGCCGCCGCCGCCGGCCCCCCCCAGCACCAGCGCCCCGGGCCGGGGGG
GGCGAGGAGGCGGGGGCGGCAGGACGGGGGGCGGGGGCGGCGGCGGCCACCTGGCCCGGACCACCGCGGC
CCGGAGGGCCGTCAACAAAGTGGTGTACGATGACCACGAGAGCGAGGAGGAGGAGGAAGAGGAGGACATG
GTCTCCGAGGAGGAGGAGGAGGAGGACGGCGACGCCGAGGAGACCCAGGATTCTGAGGACGACGAGGAGG
ATGAGATGGAAGAGGACGACGATGACTCCGATTATCCGGAGGAGATGGAAGACGACGACGACGACGCCAG
TTACTGCACGGAAAGCAGCTTCAGGAGCCATAGTACCTACAGCAGCACTCCAGGTAGGCGAAAACCAAGA
GTACATCGGCCTCGTTCTCCTATATTGGAAGAAAAAGACATCCCGCCCCTTGAATTTCCCAAGTCCTCTG
AGGATTTAATGGTGCCTAATGAGCATATAATGAATGTCATTGCCATTTACGAGGTACTGCGGAACTTTGG
CACTGTTTTGAGATTATCTCCTTTTCGCTTTGAGGACTTTTGTGCAGCTCTGGTGAGCCAAGAGCAGTGC
ACACTCATGGCAGAGATGCATGTTGTGCTTTTGAAAGCAGTTCTGCGTGAAGAAGACACTTCCAATACTA
CCTTTGGACCTGCTGATCTGAAAGATAGCGTTAATTCCACACTGTATTTCATAGATGGGATGACGTGGCC
AGAGGTGCTGCGGGTGTACTGTGAGAGTGATAAGGAGTACCATCACGTTCTTCCTTACCAAGAGGCAGAG
GACTACCCATATGGACCAGTAGAGAACAAGATCAAAGTTCTACAGTTTCTAGTCGATCAGTTTCTTACAA
CAAATATTGCTCGAGAGGAATTGATGTCTGAAGGGGTGATACAGTATGATGACCATTGTAGGGTTTGTCA
CAAACTTGGGGATTTGCTTTGCTGTGAGACATGTTCAGCAGTATACCATTTGGAATGTGTGAAGCCACCT
CTTGAGGAGGTGCCAGAGGACGAGTGGCAGTGTGAAGTCTGTGTAGCACACAAGGTGCCTGGTGTGACTG
ACTGTGTTGCTGAAATCCAAAAAAATAAACCATATATTCGACATGAACCTATTGGATATGATAGAAGTCG
GAGGAAATACTGGTTCTTGAACCGAAGACTCATAATAGAAGAAGATACAGAAAATGAAAATGAAAAGAAA
ATTTGGTATTACAGCACAAAGGTCCAACTTGCAGAATTAATTGACTGTCTAGACAAAGATTATTGGGAAG
CAGAACTCTGCAAAATTCTAGAAGAAATGCGTGAAGAAATCCACCGACACATGGACATAACTGAAGACCT
GACCAATAAGGCTCGGGGCAGTAACAAATCCTTTCTGGCGGCAGCTAATGAAGAAATTTTGGAATCCATA
AGAGCCAAAAAGGGAGACATTGATAATGTTAAAAGCCCAGAAGAAACAGAAAAAGACAAGAATGAGACTG
AGAATGACTCTAAAGATGCTGAGAAAAACAGAGAAGAATTTGAAGACCAGTCCCTTGAAAAAGACAGTGA
CGACAAAACACCAGATGATGACCCTGAGCAAGGAAAATCTGAGGTAGGTGATTTCAAATCGGAGAAGTCC
AACGGGGAGCTAAGTGAATCTCCTGGAGCTGGAAAAGGAGCATCTGGCTCAACTCGAATCATCACCAGAT
TGCGGAATCCAGATAGCAAACTTAGTCAGCTGAAGAGCCAGCAGGTGGCAGCCGCTGCACATGAAGCAAA
TAAATTATTTAAGGAGGGCAAAGAGGTACTGGTAGTTAACTCTCAAGGAGAAATTTCACGGTTGAGCACC
AAAAAGGAAGTGATCATGAAAGGAAATATCAACAATTATTTTAAATTGGGTCAAGAAGGGAAGTATCGCG
TCTACCACAATCAATACTCCACCAATTCATTTGCTTTGAATAAGCACCAGCACAGAGAAGACCATGATAA
GAGAAGGCATCTTGCACATAAGTTCTGTCTGACTCCAGCAGGAGAGTTCAAATGGAACGGTTCTGTCCAT
GGGTCCAAAGTTCTTACCATATCTACTCTGAGACTGACTATCACCCAATTAGAAAACAACATCCCTTCAT
CCTTTCTTCATCCCAACTGGGCATCACATAGGGCAAATTGGATCAAGGCAGTTCAGATGTGTAGCAAACC
CAGAGAATTTGCATTGGCTTTAGCCATTTTGGAGTGTGCAGTTAAACCAGTTGTGATGCTACCAATATGG
CGAGAATCTTTAGGACATACCAGGTTACACCGGATGACATCAATTGAAAGAGAAGAAAAGGAGAAAGTCA
AAAAAAAAGAGAAGAAACAGGAAGAAGAAGAAACGATGCAGCAAGCGACATGGGTAAAATACACATTTCC
AGTTAAGCATCAGGTTTGGAAACAAAAAGGTGAAGAGTACAGAGTGACAGGATATGGTGGTTGGAGCTGG
ATTAGTAAAACTCATGTTTATAGGTTTGTTCCTAAATTGCCAGGCAATACTAATGTGAATTACAGAAAGT
CGTTAGAAGGAACCAAAAATAATATGGATGAAAATATGGATGAGTCAGATAAAAGAAAATGTTCACGAAG
TCCAAAAAAAATAAAAATAGAGCCTGATTCTGAAAAAGATGAGGTAAAAGGTTCAGATGCTGCAAAAGGA
GCAGACCAAAATGAAATGGATATCTCAAAGATTACTGAGAAGAAGGACCAAGATGTGAAGGAGCTCTTAG
ATTCTGACAGTGATAAACCCTGCAAGGAAGAACCAATGGAAGTAGACGATGACATGAAAACAGAGTCACA
TGTAAATTGTCAGGAGAGTTCTCAAGTAGATGTGGTCAATGTTAGTGAGGGTTTTCATCTAAGGACTAGT
TACAAAAAGAAAACAAAATCATCCAAACTAGATGGACTTCTTGAAAGGAGAATTAAACAGTTTACACTGG
AAGAAAAACAGCGACTCGAAAAAATCAAGTTGGAGGGTGGAATTAAGGGTATAGGAAAGACTTCTACAAA
TTCTTCAAAAAATCTCTCTGAATCACCAGTAATAACGAAAGCAAAAGAAGGGTGTCAGAGTGACTCGATG
AGACAAGAACAGAGCCCAAATGCAAATAATGATCAACCTGAGGACTTGATTCAGGGATGTTCAGAAAGTG
ATTCCTCAGTTCTTAGAATGAGTGATCCTAGTCATACCACAAACAAACTTTATCCAAAAGATCGAGTGTT
AGATGATGTCTCCATTCGGAGCCCAGAAACAAAATGTCCGAAACAAAATTCCATTGAAAATGACATAGAA
GAAAAAGTCTCTGACCTTGCCAGTAGAGGCCAGGAACCCAGTAAGAGTAAAACAAAAGGAAATGATTTTT
TCATCGATGACTCTAAACTAGCCAGTGCAGATGATATTGGTACTTTGATCTGTAAGAACAAAAAACCGCT
CATACAGGAGGAAAGTGACACCATTGTTTCTTCTTCCAAGAGTGCTTTACATTCATCAGTGCCTAAAAGT
ACCAATGACAGAGATGCCACACCTCTGTCAAGAGCAATGGACTTTGAAGGAAAACTGGGATGTGACTCTG
AATCTAATAGCACTTTGGAAAATAGTTCTGATACCGTGTCTATTCAGGATAGCAGTGAAGAAGATATGAT
TGTTCAGAATAGCAATGAAAGCATTTCTGAACAGTTCAGAACTCGAGAACAAGATGTTGAAGTCTTGGAG
CCGTTAAAGTGTGAGTTGGTTTCTGGTGAGTCCACTGGAAACTGTGAGGACAGGCTGCCGGTCAAGGGGA
CTGAAGCAAATGGTAAAAAACCAAGTCAGCAGAAGAAATTAGAGGAGAGACCAGTTAATAAATGTAGTGA
TCAAATAAAGCTAAAAAATACCACTGACAAAAAGAATAATGAAAATCGAGAGTCTGAAAAGAAAGGACAG
AGAACAAGTACATTTCAAATAAATGGAAAAGATAATAAACCCAAAATATATTTGAAAGGTGAATGCTTGA
AAGAAATTTCTGAGAGTAGAGTAGTAAGTGGTAATGTTGAACCAAAGGTTAATAATATAAATAAAATAAT
CCCTGAGAATGATATTAAATCATTGACTGTTAAAGAATCTGCTATAAGGCCATTCATTAATGGTGATGTC
ATCATGGAAGATTTTAATGAAAGAAACAGCTCCGAAACAAAATCGCATTTGCTGAGTTCTTCAGATGCTG
AAGGTAACTACCGAGATAGCCTTGAGACCCTGCCATCAACCAAAGAGTCTGACAGTACACAGACGACCAC
ACCCTCAGCATCTTGTCCAGAAAGCAATTCAGTTAATCAGGTAGAAGATATGGAAATAGAAACCTCAGAA
GTTAAGAAAGTTACTTCATCACCTATTACTTCTGAAGAGGAATCTAATCTCAGTAATGACTTTATTGATG
AAAATGGTCTGCCCATCAACAAAAATGAAAATGTCAATGGAGAATCTAAAAGAAAAACCGTCATCACAGA
AGTCACCACGATGACCTCCACAGTGGCCACAGAATCAAAAACTGTGATCAAGGTAGAAAAAGGCGATAAG
CAAACTGTGGTTTCTTCCACAGAAAATTGTGCAAAATCCACTGTCACAACCACCACTACAACAGTGACCA
AGCTTTCCACACCCTCCACAGGCGGCAGTGTGGACATCATCTCTGTAAAGGAGCAGAGCAAAACCGTGGT
CACCACGACAGTGACAGACTCCCTGACCACCACGGGAGGCACACTGGTTACATCTATGACTGTGAGCAAA
GAGTATTCCACACGAGACAAAGTGAAACTGATGAAATTTTCAAGACCAAAGAAGACTCGTTCAGGTACAG
CTCTGCCATCCTATAGAAAATTTGTTACCAAGAGCAGCAAGAAGAGCATTTTTGTTTTGCCTAATGATGA
CTTAAAAAAGTTGGCCCGAAAAGGAGGAATCCGAGAGGTCCCTTATTTTAATTACAATGCAAAACCTGCT
TTGGATATATGGCCATATCCTTCTCCTAGACCGACCTTTGGCATCACTTGGAGGTATAGACTTCAGACAG
TAAAGTCCTTAGCTGGAGTGAGCCTGATGTTACGGTTACTGTGGGCAAGTTTGAGATGGGATGATATGGC
GGCCAAGGCTCCTCCAGGAGGAGGGACTACACGGACAGAAACATCCGAAACTGAAATCACAACAACAGAA
ATAATTAAGAGGAGAGATGTTGGTCCTTATGGCATTCGATCTGAATATTGTATCAGGAAAATCATTTGTC
CCATTGGAGTTCCAGAAACACCAAAAGAAACGCCTACACCTCAGAGGAAAGGCCTTCGATCAAGTGCACT
GCGGCCAAAGAGACCAGAAACGCCCAAGCAAACTGGCCCTGTTATTATTGAAACCTGGGTAGCAGAAGAA
GAACTGGAATTGTGGGAGATCAGGGCATTTGCTGAGAGAGTGGAGAAAGAAAAGGCACAAGCAGTTGAGC
AACAGGCTAAGAAACGACTGGAGCAGCAGAAGCCGACAGTGATTGCAACTTCCACTACTTCCCCAACAAG
CAGTACAACCAGCACCATCTCTCCAGCACAGAAGGTTATGGTGGCCCCCATAAGTGGCTCAGTTACAACT
GGAACCAAAATGGTACTAACTACTAAAGTTGGATCTCCAGCTACAGTAACATTCCAACAAAACAAGAACT
TTCATCAAACCTTTGCTACATGGGTTAAGCAAGGCCAGTCAAATTCAGGCGTTGTTCAAGTACAGCAGAA
AGTCCTGGGTATCATTCCATCAAGTACAGGTACCAGTCAGCAAACCTTTACTTCATTCCAGCCCAGGACA
GCAACAGTCACAATTAGGCCCAATACCTCAGGCTCTGGAGGAACCACAAGCAATTCACAAGTAATCACAG
GGCCTCAGATTCGCCCTGGTATGACCGTGATTAGAACACCACTCCAACAGTCAACACTAGGAAAGGCAAT
TATTCGAACACCTGTGATGGTACAGCCAGGTGCTCCTCAGCAAGTGATGACTCAAATCATCAGGGGGCAG
CCTGTCTCCACTGCAGTCTCCGCCCCTAACACGGTTTCCTCAACACCTGGGCAGAAAAGCTTAACTTCAG
CAACGTCCACTTCAAATATACAGTCTTCAGCCTCACAACCCCCTCGCCCCCAACAAGGACAAGTGAAGCT
CACCATGGCTCAACTTACTCAGTTAACACAGGGCCACGGTGGCAATCAAGGTTTGACAGTAGTAATTCAA
GGACAAGGTCAAACTACTGGACAGTTGCAGTTGATACCTCAAGGGGTGACTGTACTCCCAGGCCCAGGCC
AGCAGCTAATGCAAGCTGCAATGCCAAATGGTACTGTTCAGCGATTCCTCTTTACCCCATTGGCAACAAC
AGCCACCACAGCCAGCACCACCACCACCACTGTTTCCACGACAGCAGCAGGTACAGGTGAACAAAGGCAG
AGTAAACTGTCACCCCAGATGCAGGTACATCAAGACAAAACCCTGCCACCAGCTCAGTCATCAAGTGTGG
GTCCAGCAGAAGCCCAGCCACAGACTGCTCAGCCTTCAGCTCAGCCCCAGCCCCAAACCCAGCCCCAGTC
CCCAGCTCAGCCTGAAGTTCAGACTCAGCCTGAAGTTCAGACCCAAACAACTGTTTCATCCCATGTCCCT
TCTGAAGCACAACCCACCCACGCACAGTCATCCAAGCCCCAAGTTGCAGCACAGTCTCAGCCTCAAAGTA
ATGTCCAAGGACAGTCTCCTGTTCGTGTCCAAAGTCCATCACAGACTCGAATACGTCCATCAACTCCATC
CCAACTGTCTCCTGGACAACAATCCCAGGTTCAGACTACAACCTCACAACCGATTCCAATTCAACCACAT
ACATCTCTTCAGATACCTTCCCAAGGCCAGCCACAGTCACAACCCCAGGTACAGTCTTCAACTCAAACTC
TTTCATCAGGACAAACTTTAAATCAAGTTACTGTTTCATCCCCATCCCGTCCTCAGCTACAAATACAGCA
GCCACAGCCCCAAGTCATTGCTGTGCCTCAGCTGCAACAACAAGTCCAGGTTCTCTCTCAGATCCAGTCA
CAGGTTGTGGCTCAGATACAGGCTCAGCAAAGTGGTGTGCCCCAGCAAATCAAACTCCAGTTACCTATCC
AAATTCAGCAAAGCAGTGCTGTGCAGACTCACCAGATTCAGAATGTGGTTACAGTGCAGGCAGCCAGTGT
GCAAGAGCAGTTGCAAAGGGTTCAGCAACTCAGGGATCAGCAGCAAAAGAAGAAACAGCAACAGATAGAA
ATTAAGCGTGAACACACCCTCCAAGCTTCTAATCAAAGTGAAATCATTCAGAAACAGGTGGTGATGAAGC
ATAATGCTGTAATAGAACATTTAAAACAGAAAAAGAGCATGACTCCAGCTGAAAGAGAAGAGAATCAAAG
AATGATTGTCTGTAACCAGGTGATGAAGTATATTTTGGATAAGATAGATAAAGAAGAAAAACAGGCAGCA
AAAAAACGGAAGCGTGAAGAGAGTGTGGAGCAGAAACGTAGCAAGCAGAATGCCACTAAGCTGTCAGCTC
TGCTCTTCAAGCACAAAGAGCAGCTCAGAGCCGAGATCCTGAAGAAGAGAGCACTCCTGGACAAGGATCT
GCAAATTGAAGTGCAGGAAGAGCTGAAGAGAGACCTGAAAATTAAGAAAGAAAAAGACCTGATGCAGTTG
GCTCAGGCCACAGCAGTAGCTGCACCCTGCCCCCCAGTGACACCAGCTCCTCCAGCCCCTCCAGCCCCTC
CACCCCCTCCACCTTCACCTCCCCCTCCACCTGCTGTGCAACACACAGGCCTTCTGTCCACGCCCACCTT
ACCTGCTGCTTCCCAGAAGAGGAAGCGGGAAGAGGAAAAAGACTCCAGCTCAAAGTCCAAGAAAAAGAAA
ATGATCTCTACTACCTCAAAGGAAACTAAGAAGGACACAAAGCTTTACTGTATCTGTAAAACGCCTTATG
ATGAATCTAAATTTTATATTGGCTGTGATCGGTGTCAGAATTGGTACCATGGGCGCTGCGTTGGCATCTT
GCAAAGTGAGGCAGAGCTCATTGATGAGTATGTCTGTCCACAGTGCCAGTCAACAGAGGATGCCATGACA
GTGCTCACGCCACTAACAGAGAAGGATTATGAGGGGTTGAAGAGGGTGCTCCGTTCCTTACAGGCCCATA
AGATGGCCTGGCCTTTCCTTGAACCAGTAGACCCTAATGATGCACCAGATTATTATGGTGTTATTAAGGA
ACCTATGGACCTTGCCACCATGGAAGAAAGAGTACAAAGACGATATTATGAAAAGCTGACGGAATTTGTG
GCAGATATGACCAAAATTTTTGATAACTGTCGTTACTACAATCCAAGTGACTCCCCATTTTACCAGTGTG
CAGAAGTTCTCGAATCATTCTTTGTACAGAAATTGAAAGGCTTCAAAGCTAGCAGGTCTCATAACAACAA
ACTGCAGTCTACAGCTTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217011 representing NM_182641
Red=Cloning site Green=Tags(s)

MRGRRGRPPKQPAAPAAERCAPAPPPPPPPPTSGPIGGLRSRHRGSSRGRWAAAQAEVAPKTRLSSPRGG
SSSRRKPPPPPPAPPSTSAPGRGGRGGGGGRTGGGGGGGHLARTTAARRAVNKVVYDDHESEEEEEEEDM
VSEEEEEEDGDAEETQDSEDDEEDEMEEDDDDSDYPEEMEDDDDDASYCTESSFRSHSTYSSTPGRRKPR
VHRPRSPILEEKDIPPLEFPKSSEDLMVPNEHIMNVIAIYEVLRNFGTVLRLSPFRFEDFCAALVSQEQC
TLMAEMHVVLLKAVLREEDTSNTTFGPADLKDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAE
DYPYGPVENKIKVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPP
LEEVPEDEWQCEVCVAHKVPGVTDCVAEIQKNKPYIRHEPIGYDRSRRKYWFLNRRLIIEEDTENENEKK
IWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEILESI
RAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQSLEKDSDDKTPDDDPEQGKSEVGDFKSEKS
NGELSESPGAGKGASGSTRIITRLRNPDSKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLST
KKEVIMKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVH
GSKVLTISTLRLTITQLENNIPSSFLHPNWASHRANWIKAVQMCSKPREFALALAILECAVKPVVMLPIW
RESLGHTRLHRMTSIEREEKEKVKKKEKKQEEEETMQQATWVKYTFPVKHQVWKQKGEEYRVTGYGGWSW
ISKTHVYRFVPKLPGNTNVNYRKSLEGTKNNMDENMDESDKRKCSRSPKKIKIEPDSEKDEVKGSDAAKG
ADQNEMDISKITEKKDQDVKELLDSDSDKPCKEEPMEVDDDMKTESHVNCQESSQVDVVNVSEGFHLRTS
YKKKTKSSKLDGLLERRIKQFTLEEKQRLEKIKLEGGIKGIGKTSTNSSKNLSESPVITKAKEGCQSDSM
RQEQSPNANNDQPEDLIQGCSESDSSVLRMSDPSHTTNKLYPKDRVLDDVSIRSPETKCPKQNSIENDIE
EKVSDLASRGQEPSKSKTKGNDFFIDDSKLASADDIGTLICKNKKPLIQEESDTIVSSSKSALHSSVPKS
TNDRDATPLSRAMDFEGKLGCDSESNSTLENSSDTVSIQDSSEEDMIVQNSNESISEQFRTREQDVEVLE
PLKCELVSGESTGNCEDRLPVKGTEANGKKPSQQKKLEERPVNKCSDQIKLKNTTDKKNNENRESEKKGQ
RTSTFQINGKDNKPKIYLKGECLKEISESRVVSGNVEPKVNNINKIIPENDIKSLTVKESAIRPFINGDV
IMEDFNERNSSETKSHLLSSSDAEGNYRDSLETLPSTKESDSTQTTTPSASCPESNSVNQVEDMEIETSE
VKKVTSSPITSEEESNLSNDFIDENGLPINKNENVNGESKRKTVITEVTTMTSTVATESKTVIKVEKGDK
QTVVSSTENCAKSTVTTTTTTVTKLSTPSTGGSVDIISVKEQSKTVVTTTVTDSLTTTGGTLVTSMTVSK
EYSTRDKVKLMKFSRPKKTRSGTALPSYRKFVTKSSKKSIFVLPNDDLKKLARKGGIREVPYFNYNAKPA
LDIWPYPSPRPTFGITWRYRLQTVKSLAGVSLMLRLLWASLRWDDMAAKAPPGGGTTRTETSETEITTTE
IIKRRDVGPYGIRSEYCIRKIICPIGVPETPKETPTPQRKGLRSSALRPKRPETPKQTGPVIIETWVAEE
ELELWEIRAFAERVEKEKAQAVEQQAKKRLEQQKPTVIATSTTSPTSSTTSTISPAQKVMVAPISGSVTT
GTKMVLTTKVGSPATVTFQQNKNFHQTFATWVKQGQSNSGVVQVQQKVLGIIPSSTGTSQQTFTSFQPRT
ATVTIRPNTSGSGGTTSNSQVITGPQIRPGMTVIRTPLQQSTLGKAIIRTPVMVQPGAPQQVMTQIIRGQ
PVSTAVSAPNTVSSTPGQKSLTSATSTSNIQSSASQPPRPQQGQVKLTMAQLTQLTQGHGGNQGLTVVIQ
GQGQTTGQLQLIPQGVTVLPGPGQQLMQAAMPNGTVQRFLFTPLATTATTASTTTTTVSTTAAGTGEQRQ
SKLSPQMQVHQDKTLPPAQSSSVGPAEAQPQTAQPSAQPQPQTQPQSPAQPEVQTQPEVQTQTTVSSHVP
SEAQPTHAQSSKPQVAAQSQPQSNVQGQSPVRVQSPSQTRIRPSTPSQLSPGQQSQVQTTTSQPIPIQPH
TSLQIPSQGQPQSQPQVQSSTQTLSSGQTLNQVTVSSPSRPQLQIQQPQPQVIAVPQLQQQVQVLSQIQS
QVVAQIQAQQSGVPQQIKLQLPIQIQQSSAVQTHQIQNVVTVQAASVQEQLQRVQQLRDQQQKKKQQQIE
IKREHTLQASNQSEIIQKQVVMKHNAVIEHLKQKKSMTPAEREENQRMIVCNQVMKYILDKIDKEEKQAA
KKRKREESVEQKRSKQNATKLSALLFKHKEQLRAEILKKRALLDKDLQIEVQEELKRDLKIKKEKDLMQL
AQATAVAAPCPPVTPAPPAPPAPPPPPPSPPPPPAVQHTGLLSTPTLPAASQKRKREEEKDSSSKSKKKK
MISTTSKETKKDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMT
VLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFV
ADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSHNNKLQSTAS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_182641
ORF Size 8769 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_182641.2, NM_182641.3, NP_872579
RefSeq Size 10935
RefSeq ORF 8763
Locus ID 2186
Cytogenetics 17q24.2
Protein Families Druggable Genome
MW 324.9 kDa
Gene Summary This gene was identified by the reactivity of its encoded protein to a monoclonal antibody prepared against brain homogenates from patients with Alzheimer's disease. Analysis of the original protein (fetal Alz-50 reactive clone 1, or FAC1), identified as an 810 aa protein containing a DNA-binding domain and a zinc finger motif, suggested it might play a role in the regulation of transcription. High levels of FAC1 were detected in fetal brain and in patients with neurodegenerative diseases. The protein encoded by this gene is actually much larger than originally thought, and it also contains a C-terminal bromodomain characteristic of proteins that regulate transcription during proliferation. The encoded protein is highly similar to the largest subunit of the Drosophila NURF (nucleosome remodeling factor) complex. In Drosophila, the NURF complex, which catalyzes nucleosome sliding on DNA and interacts with sequence-specific transcription factors, is necessary for the chromatin remodeling required for transcription. Two alternative transcripts encoding different isoforms have been described completely. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)