PRCD (NM_001077620) Human Tagged ORF Clone
CAT#: RC216764
PRCD (Myc-DDK-tagged)-Human progressive rod-cone degeneration (PRCD), transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_001077620" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | PRCD |
Synonyms | RP36 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC216764 representing NM_001077620
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGCACCACCCTTTTCCTGCTCAGCACCCTGGCCATGCTCTGGCGCCGCCGATTTGCCAACCGAGTCC AACCAGAGCCCAGCGACGTGGATGGGGCAGCTAGGGGCAGCAGCTTGGATGCGGACCCTCAGTCCTCAGG CAGGGAGAAAGAACCTCTGAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC216764 representing NM_001077620
Red=Cloning site Green=Tags(s) MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001077620 |
ORF Size | 162 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001077620.3 |
RefSeq Size | 937 bp |
RefSeq ORF | 165 bp |
Locus ID | 768206 |
UniProt ID | Q00LT1 |
Cytogenetics | 17q25.1 |
MW | 5.8 kDa |
Gene Summary | This gene is predominantly expressed in the retina, and mutations in this gene are the cause of autosomal recessive retinal degeneration in both humans and dogs. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2010] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC216764L1 | Lenti ORF clone of Human progressive rod-cone degeneration (PRCD), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC216764L2 | Lenti ORF clone of Human progressive rod-cone degeneration (PRCD), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RC216764L3 | Lenti ORF clone of Human progressive rod-cone degeneration (PRCD), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC216764L4 | Lenti ORF clone of Human progressive rod-cone degeneration (PRCD), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RG216764 | PRCD (tGFP-tagged) - Human progressive rod-cone degeneration (PRCD), transcript variant 1 |
USD 350.00 |
|
SC315463 | PRCD (untagged)-Human progressive rod-cone degeneration (PRCD), transcript variant 1 |
USD 165.00 |
{0} Product Review(s)
Be the first one to submit a review