CD45 (PTPRC) (NM_002838) Human Tagged ORF Clone

CAT#: RC216590

Reviews ()
Write a review

PTPRC (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, C (PTPRC), transcript variant 1



Reconstitution Protocol

USD 1,137.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PTPRC"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PTPRC
Synonyms B220; CD45; CD45R; GP180; L-CA; LCA; LY5; T200
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216590 representing NM_002838.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGTATTTGTGGCTTAAACTCTTGGCATTTGGCTTTGCCTTTCTGGACACAGAAGTATTTGTGACAGGG
CAAAGCCCAACACCTTCCCCCACTGGATTGACTACAGCAAAGATGCCCAGTGTTCCACTTTCAAGTGAC
CCCTTACCTACTCACACCACTGCATTCTCACCCGCAAGCACCTTTGAAAGAGAAAATGACTTCTCAGAG
ACCACAACTTCTCTTAGTCCAGACAATACTTCCACCCAAGTATCCCCGGACTCTTTGGATAATGCTAGT
GCTTTTAATACCACAGGTGTTTCATCAGTACAGACGCCTCACCTTCCCACGCACGCAGACTCGCAGACG
CCCTCTGCTGGAACTGACACGCAGACATTCAGCGGCTCCGCCGCCAATGCAAAACTCAACCCTACCCCA
GGCAGCAATGCTATCTCAGATGTCCCAGGAGAGAGGAGTACAGCCAGCACCTTTCCTACAGACCCAGTT
TCCCCATTGACAACCACCCTCAGCCTTGCACACCACAGCTCTGCTGCCTTACCTGCACGCACCTCCAAC
ACCACCATCACAGCGAACACCTCAGATGCCTACCTTAATGCCTCTGAAACAACCACTCTGAGCCCTTCT
GGAAGCGCTGTCATTTCAACCACAACAATAGCTACTACTCCATCTAAGCCAACATGTGATGAAAAATAT
GCAAACATCACTGTGGATTACTTATATAACAAGGAAACTAAATTATTTACAGCAAAGCTAAATGTTAAT
GAGAATGTGGAATGTGGAAACAATACTTGCACAAACAATGAGGTGCATAACCTTACAGAATGTAAAAAT
GCGTCTGTTTCCATATCTCATAATTCATGTACTGCTCCTGATAAGACATTAATATTAGATGTGCCACCA
GGGGTTGAAAAGTTTCAGTTACATGATTGTACACAAGTTGAAAAAGCAGATACTACTATTTGTTTAAAA
TGGAAAAATATTGAAACCTTTACTTGTGATACACAGAATATTACCTACAGATTTCAGTGTGGTAATATG
ATATTTGATAATAAAGAAATTAAATTAGAAAACCTTGAACCCGAACATGAGTATAAGTGTGACTCAGAA
ATACTCTATAATAACCACAAGTTTACTAACGCAAGTAAAATTATTAAAACAGATTTTGGGAGTCCAGGA
GAGCCTCAGATTATTTTTTGTAGAAGTGAAGCTGCACATCAAGGAGTAATTACCTGGAATCCCCCTCAA
AGATCATTTCATAATTTTACCCTCTGTTATATAAAAGAGACAGAAAAAGATTGCCTCAATCTGGATAAA
AACCTGATCAAATATGATTTGCAAAATTTAAAACCTTATACGAAATATGTTTTATCATTACATGCCTAC
ATCATTGCAAAAGTGCAACGTAATGGAAGTGCTGCAATGTGTCATTTCACAACTAAAAGTGCTCCTCCA
AGCCAGGTCTGGAACATGACTGTCTCCATGACATCAGATAATAGTATGCATGTCAAGTGTAGGCCTCCC
AGGGACCGTAATGGCCCCCATGAACGTTACCATTTGGAAGTTGAAGCTGGAAATACTCTGGTTAGAAAT
GAGTCGCATAAGAATTGCGATTTCCGTGTAAAAGATCTTCAATATTCAACAGACTACACTTTTAAGGCC
TATTTTCACAATGGAGACTATCCTGGAGAACCCTTTATTTTACATCATTCAACATCTTATAATTCTAAG
GCACTGATAGCATTTCTGGCATTTCTGATTATTGTGACATCAATAGCCCTGCTTGTTGTTCTCTACAAA
ATCTATGATCTACATAAGAAAAGATCCTGCAATTTAGATGAACAGCAGGAGCTTGTTGAAAGGGATGAT
GAAAAACAACTGATGAATGTGGAGCCAATCCATGCAGATATTTTGTTGGAAACTTATAAGAGGAAGATT
GCTGATGAAGGAAGACTTTTTCTGGCTGAATTTCAGAGCATCCCGCGGGTGTTCAGCAAGTTTCCTATA
AAGGAAGCTCGAAAGCCCTTTAACCAGAATAAAAACCGTTATGTTGACATTCTTCCTTATGATTATAAC
CGTGTTGAACTCTCTGAGATAAACGGAGATGCAGGGTCAAACTACATAAATGCCAGCTATATTGATGGT
TTCAAAGAACCCAGGAAATACATTGCTGCACAAGGTCCCAGGGATGAAACTGTTGATGATTTCTGGAGG
ATGATTTGGGAACAGAAAGCCACAGTTATTGTCATGGTCACTCGATGTGAAGAAGGAAACAGGAACAAG
TGTGCAGAATACTGGCCGTCAATGGAAGAGGGCACTCGGGCTTTTGGAGATGTTGTTGTAAAGATCAAC
CAGCACAAAAGATGTCCAGATTACATCATTCAGAAATTGAACATTGTAAATAAAAAAGAAAAAGCAACT
GGAAGAGAGGTGACTCACATTCAGTTCACCAGCTGGCCAGACCACGGGGTGCCTGAGGATCCTCACTTG
CTCCTCAAACTGAGAAGGAGAGTGAATGCCTTCAGCAATTTCTTCAGTGGTCCCATTGTGGTGCACTGC
AGTGCTGGTGTTGGGCGCACAGGAACCTATATCGGAATTGATGCCATGCTAGAAGGCCTGGAAGCCGAG
AACAAAGTGGATGTTTATGGTTATGTTGTCAAGCTAAGGCGACAGAGATGCCTGATGGTTCAAGTAGAG
GCCCAGTACATCTTGATCCATCAGGCTTTGGTGGAATACAATCAGTTTGGAGAAACAGAAGTGAATTTG
TCTGAATTACATCCATATCTACATAACATGAAGAAAAGGGATCCACCCAGTGAGCCGTCTCCACTAGAG
GCTGAATTCCAGAGACTTCCTTCATATAGGAGCTGGAGGACACAGCACATTGGAAATCAAGAAGAAAAT
AAAAGTAAAAACAGGAATTCTAATGTCATCCCATATGACTATAACAGAGTGCCACTTAAACATGAGCTG
GAAATGAGTAAAGAGAGTGAGCATGATTCAGATGAATCCTCTGATGATGACAGTGATTCAGAGGAACCA
AGCAAATACATCAATGCATCTTTTATAATGAGCTACTGGAAACCTGAAGTGATGATTGCTGCTCAGGGA
CCACTGAAGGAGACCATTGGTGACTTTTGGCAGATGATCTTCCAAAGAAAAGTCAAAGTTATTGTTATG
CTGACAGAACTGAAACATGGAGACCAGGAAATCTGTGCTCAGTACTGGGGAGAAGGAAAGCAAACATAT
GGAGATATTGAAGTTGACCTGAAAGACACAGACAAATCTTCAACTTATACCCTTCGTGTCTTTGAACTG
AGACATTCCAAGAGGAAAGACTCTCGAACTGTGTACCAGTACCAATATACAAACTGGAGTGTGGAGCAG
CTTCCTGCAGAACCCAAGGAATTAATCTCTATGATTCAGGTCGTCAAACAAAAACTTCCCCAGAAGAAT
TCCTCTGAAGGGAACAAGCATCACAAGAGTACACCTCTACTCATTCACTGCAGGGATGGATCTCAGCAA
ACGGGAATATTTTGTGCTTTGTTAAATCTCTTAGAAAGTGCGGAAACAGAAGAGGTAGTGGATATTTTT
CAAGTGGTAAAAGCTCTACGCAAAGCTAGGCCAGGCATGGTTTCCACATTCGAGCAATATCAATTCCTA
TATGACGTCATTGCCAGCACCTACCCTGCTCAGAATGGACAAGTAAAGAAAAACAACCATCAAGAAGAT
AAAATTGAATTTGATAATGAAGTGGACAAAGTAAAGCAGGATGCTAATTGTGTTAATCCACTTGGTGCC
CCAGAAAAGCTCCCTGAAGCAAAGGAACAGGCTGAAGGTTCTGAACCCACGAGTGGCACTGAGGGGCCA
GAACATTCTGTCAATGGTCCTGCAAGTCCAGCTTTAAATCAAGGTTCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC216590
Blue=ORF Red=Cloning site Green=Tag(s)

MYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSE
TTTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGTDTQTFSGSAANAKLNPTP
GSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAALPARTSNTTITANTSDAYLNASETTTLSPS
GSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKN
ASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNM
IFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQ
RSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPP
SQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKA
YFHNGDYPGEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYKIYDLHKKRSCNLDEQQELVERDD
EKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSIPRVFSKFPIKEARKPFNQNKNRYVDILPYDYN
RVELSEINGDAGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNK
CAEYWPSMEEGTRAFGDVVVKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHL
LLKLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVE
AQYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHIGNQEEN
KSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVMIAAQG
PLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEVDLKDTDKSSTYTLRVFEL
RHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISMIQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQ
TGIFCALLNLLESAETEEVVDIFQVVKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQED
KIEFDNEVDKVKQDANCVNPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002838
ORF Size 3918 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002838.3
RefSeq Size 5026 bp
RefSeq ORF 3921 bp
Locus ID 5788
UniProt ID P08575
Cytogenetics 1q31.3-q32.1
Domains Y_phosphatase, PTPc_motif, FN3
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Phosphatase, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Fc gamma R-mediated phagocytosis, Primary immunodeficiency, T cell receptor signaling pathway
MW 147.3 kDa
Gene Summary The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. This PTP also suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Alternatively spliced transcripts variants of this gene, which encode distinct isoforms, have been reported. [provided by RefSeq, Jun 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.