RAET1L (NM_130900) Human Tagged ORF Clone

CAT#: RC215850

RAET1L (Myc-DDK-tagged)-Human retinoic acid early transcript 1L (RAET1L)

Product Images

Circular map for RC215850

• 

  Western blot validation of overexpression lysate (Cat# LY408885) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC215850 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RAET1L
• Synonyms: ULBP6
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC215850 representing NM_130900.
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
  GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
  ATGGCAGCAGCCGCCATCCCAGCTTTGCTTCTGTGCCTCCCGCTTCTGTTCCTGCTGTTCGGCTGGTCC
  CGGGCTAGGCGAGACGACCCTCACTCTCTTTGCTATGACATCACCGTCATCCCTAAGTTCAGACCTGGA
  CCACGGTGGTGTGCGGTTCAAGGCCAGGTGGATGAAAAGACTTTTCTTCACTATGACTGTGGCAACAAG
  ACAGTCACACCCGTCAGTCCCCTGGGGAAGAAACTAAATGTCACAATGGCCTGGAAAGCACAGAACCCA
  GTACTGAGAGAGGTGGTGGACATACTTACAGAGCAACTGCTTGACATTCAGCTGGAGAATTACACACCC
  AAGGAACCCCTCACCCTGCAGGCAAGGATGTCTTGTGAGCAGAAAGCTGAAGGACACAGCAGTGGATCT
  TGGCAGTTCAGTATCGATGGACAGACCTTCCTACTCTTTGACTCAGAGAAGAGAATGTGGACAACGGTT
  CATCCTGGAGCCAGAAAGATGAAAGAAAAGTGGGAGAATGACAAGGATGTGGCCATGTCCTTCCATTAC
  ATCTCAATGGGAGACTGCATAGGATGGCTTGAGGACTTCTTGATGGGCATGGACAGCACCCTGGAGCCA
  AGTGCAGGAGCACCACTCGCCATGTCCTCAGGCACAACCCAACTCAGGGCCACAGCCACCACCCTCATC
  CTTTGCTGCCTCCTCATCATCCTCCCCTGCTTCATCCTCCCTGGCATC
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
  TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC
  
  Protein Sequence

  >Peptide sequence encoded by RC215850
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNK
  TVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGS
  WQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEP
  SAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI
  myc-FLAG tag
  
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_130900
• ORF Size: 738 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_130900.3
• RefSeq Size: 741 bp
• RefSeq ORF: 741 bp
• Locus ID: 154064
• UniProt ID: Q5VY80
• Cytogenetics: 6q25.1
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Natural killer cell mediated cytotoxicity
• MW: 27.5 kDa
• Gene Summary: RAET1L belongs to the RAET1 family of major histocompatibility complex (MHC) class I-related genes, which are located within a 180-kb cluster on chromosome 6q24.2-q25.3. The REAT1 genes encode glycoproteins that contain extracellular alpha-1 and alpha-2 domains, but they lack the membrane proximal Ig-like alpha-3 domain. Most RAET1 glycoproteins are anchored to the membrane via glycosylphosphatidylinositol (GPI) linkage (Radosavljevic et al., 2002 [PubMed 11827464]).[supplied by OMIM, Mar 2008]