GCNT2 (NM_001491) Human Tagged ORF Clone

CAT#: RC215597

GCNT2 (Myc-DDK-tagged)-Human glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) (GCNT2), transcript variant 2

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name GCNT2 (NM_001491) Human Tagged ORF Clone
Symbol GCNT2
Synonyms bA360O19.2; bA421M1.1; CCAT; CTRCT13; GCNT2C; GCNT5; IGNT; II; NACGT1; NAGCT1; ULG3
Vector pCMV6-Entry
Sequence Data
>RC215597 representing NM_001491
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTTTATCAATGCGTTACCTCTTCATAATTTCTGTCTCTAGTGTAATTATTTTTATCGTCTTCTCTG
TGTTCAATTTTGGGGGAGATCCAAGCTTCCAAAGGCTAAATATCTCAGACCCTTTGAGGCTGACTCAAGT
TTGCACATCTTTTATCAATGGAAAAACACGTTTCCTGTGGAAAAACAAACTAATGATCCATGAGAAGTCT
TCTTGCAAGGAATACTTGACCCAGAGCCACTACATCACAGCCCCTTTATCTAAGGAAGAAGCTGACTTTC
CCTTGGCATATATAATGGTCATCCATCATCACTTTGACACCTTTGCAAGGCTCTTCAGGGCTATTTACAT
GCCCCAAAATATCTACTGTGTTCATGTGGATGAAAAAGCAACAACTGAATTTAAAGATGCGGTAGAGCAA
CTATTAAGCTGCTTCCCAAACGCTTTTCTGGCTTCCAAGATGGAACCCGTTGTCTATGGAGGGATCTCCA
GGCTCCAGGCTGACCTGAACTGCATCAGAGATCTTTCTGCCTTCGAGGTCTCATGGAAGTACGTTATCAA
CACCTGTGGGCAAGACTTCCCCCTGAAAACCAACAAGGAAATAGTTCAGTATCTGAAAGGATTTAAAGGT
AAAAATATCACCCCAGGGGTGCTGCCCCCAGCTCATGCAATTGGACGGACTAAATATGTCCACCAAGAGC
ACCTGGGCAAAGAGCTTTCCTATGTGATAAGAACAACAGCGTTGAAACCGCCTCCCCCCCATAATCTCAC
AATTTACTTTGGCTCTGCCTATGTGGCTCTATCAAGAGAGTTTGCCAACTTTGTTCTGCATGACCCACGG
GCTGTTGATTTGCTCCAGTGGTCCAAGGACACTTTCAGTCCTGATGAGCATTTCTGGGTGACACTCAATA
GGATTCCAGGTGTTCCTGGCTCTATGCCAAATGCATCCTGGACTGGAAACCTCAGAGCTATAAAGTGGAG
TGACATGGAAGACAGACACGGAGGCTGCCACGGCCACTATGTACATGGTATTTGTATCTATGGAAACGGA
GACTTAAAGTGGCTGGTTAATTCACCAAGCCTGTTTGCTAACAAGTTTGAGCTTAATACCTACCCCCTTA
CTGTGGAATGCCTAGAACTGAGGCATCGCGAAAGAACCCTCAATCAGAGTGAAACTGCGATACAACCCAG
CTGGTATTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215597 representing NM_001491
Red=Cloning site Green=Tags(s)

MPLSMRYLFIISVSSVIIFIVFSVFNFGGDPSFQRLNISDPLRLTQVCTSFINGKTRFLWKNKLMIHEKS
SCKEYLTQSHYITAPLSKEEADFPLAYIMVIHHHFDTFARLFRAIYMPQNIYCVHVDEKATTEFKDAVEQ
LLSCFPNAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKG
KNITPGVLPPAHAIGRTKYVHQEHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLHDPR
AVDLLQWSKDTFSPDEHFWVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNG
DLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001491
ORF Size 1200 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001491.1, NM_001491.2, NP_001482
RefSeq Size 4691
RefSeq ORF 1203
Locus ID 2651
Cytogenetics 6p24.3-p24.2
Domains Branch
Protein Families Transmembrane, Druggable Genome
Protein Pathways Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways
MW 45.7 kDa
Gene Summary This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)