MAP3K9 (NM_033141) Human Tagged ORF Clone

CAT#: RC215441

Reviews ()
Write a review

MAP3K9 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 9 (MAP3K9)



  "NM_033141" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 973.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "MAP3K9"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MAP3K9
Synonyms MEKK9; MLK1; PRKE1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215441 representing NM_033141
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCCTCCAGAGCGCTTCTCGGCTGCCTAGCGAGCGCCGCCGCTGCCGCCCCGCCGGGGGAGGATG
GAGCAGGGGCCGGGGCCGAGGAGGAGGAGGAGGAGGAGGAGGAGGCGGCGGCGGCGGTGGGCCCCGGGGA
GCTGGGCTGCGACGCGCCGCTGCCCTACTGGACGGCCGTGTTCGAGTACGAGGCGGCGGGCGAGGACGAG
CTGACCCTGCGGCTGGGCGACGTGGTGGAGGTGCTGTCCAAGGACTCGCAGGTGTCCGGCGACGAGGGCT
GGTGGACCGGGCAGCTGAACCAGCGGGTGGGCATCTTCCCCAGCAACTACGTGACCCCGCGCAGCGCCTT
CTCCAGCCGCTGCCAGCCCGGCGGCGAGGACCCCAGTTGCTACCCGCCCATTCAGTTGTTAGAAATTGAT
TTTGCGGAGCTCACCTTGGAAGAGATTATTGGCATCGGGGGCTTTGGGAAGGTCTATCGTGCTTTCTGGA
TAGGGGATGAGGTTGCTGTGAAAGCAGCTCGCCACGACCCTGATGAGGACATCAGCCAGACCATAGAGAA
TGTTCGCCAAGAGGCCAAGCTCTTCGCCATGCTGAAGCACCCCAACATCATTGCCCTAAGAGGGGTATGT
CTGAAGGAGCCCAACCTCTGCTTGGTCATGGAGTTTGCTCGTGGAGGACCTTTGAATAGAGTGTTATCTG
GGAAAAGGATTCCCCCAGACATCCTGGTGAATTGGGCTGTGCAGATTGCCAGAGGGATGAACTACTTACA
TGATGAGGCAATTGTTCCCATCATCCACCGCGACCTTAAGTCCAGCAACATATTGATCCTCCAGAAGGTG
GAGAATGGAGACCTGAGCAACAAGATTCTGAAGATCACTGATTTTGGCCTGGCTCGGGAATGGCACCGAA
CCACCAAGATGAGTGCGGCAGGGACGTATGCTTGGATGGCACCCGAAGTCATCCGGGCCTCCATGTTTTC
CAAAGGCAGTGATGTGTGGAGCTATGGGGTGCTACTTTGGGAGTTGCTGACTGGTGAGGTGCCCTTTCGA
GGCATTGATGGCTTAGCAGTCGCTTATGGAGTGGCCATGAACAAACTCGCCCTTCCTATTCCTTCTACGT
GCCCAGAACCTTTTGCCAAACTCATGGAAGACTGCTGGAATCCTGATCCCCACTCACGACCATCTTTCAC
GAATATCCTGGACCAGCTAACCACCATAGAGGAGTCTGGTTTCTTTGAAATGCCCAAGGACTCCTTCCAC
TGCCTGCAGGACAACTGGAAACACGAGATTCAGGAGATGTTTGACCAACTCAGGGCCAAAGAAAAGGAAC
TTCGCACCTGGGAGGAGGAGCTGACGCGGGCTGCACTGCAGCAGAAGAACCAGGAGGAACTGCTGCGGCG
TCGGGAGCAGGAGCTGGCCGAGCGGGAGATTGACATCCTGGAACGGGAGCTCAACATCATCATCCACCAG
CTGTGCCAGGAGAAGCCCCGGGTGAAGAAACGCAAGGGCAAGTTCAGGAAGAGCCGGCTGAAGCTCAAGG
ATGGCAACCGCATCAGCCTCCCTTCTGATTTCCAGCACAAGTTCACGGTGCAGGCCTCCCCTACCATGGA
TAAAAGGAAGAGTCTTATCAACAGCCGCTCCAGTCCTCCTGCAAGCCCCACCATCATTCCTCGCCTTCGA
GCCATCCAGTTGACACCAGGTGAAAGCAGCAAAACCTGGGGCAGGAGCTCAGTCGTCCCAAAGGAGGAAG
GGGAGGAGGAGGAGAAGAGGGCCCCAAAGAAGAAGGGACGGACGTGGGGGCCAGGGACGCTTGGTCAGAA
GGAGCTTGCCTCGGGAGATGAAGGATCCCCTCAGAGACGTGAGAAAGCTAATGGTTTAAGTACCCCATCA
GAATCTCCACATTTCCACTTGGGCCTCAAGTCCCTGGTAGATGGATATAAGCAGTGGTCGTCCAGTGCCC
CCAACCTGGTGAAGGGCCCAAGGAGTAGCCCGGCCCTGCCAGGGTTCACCAGCCTTATGGAGATGGCCTT
GCTGGCAGCCAGTTGGGTGGTGCCCATCGACATTGAAGAGGATGAGGACAGTGAAGGCCCAGGGAGTGGA
GAGAGTCGCCTACAGCATTCACCCAGCCAGTCCTACCTCTGTATCCCATTCCCTCGTGGAGAGGATGGCG
ATGGCCCCTCCAGTGATGGAATCCATGAGGAGCCCACCCCAGTCAACTCGGCCACGAGTACCCCTCAGCT
GACGCCAACCAACAGCCTCAAGCGGGGCGGTGCCCACCACCGCCGCTGCGAGGTGGCTCTGCTCGGCTGT
GGGGCTGTTCTGGCAGCCACAGGCCTAGGGTTTGACTTGCTGGAAGCTGGCAAGTGCCAGCTGCTTCCCC
TGGAGGAGCCTGAGCCACCAGCCCGGGAGGAGAAGAAAAGACGGGAGGGTCTTTTTCAGAGGTCCAGCCG
TCCTCGTCGGAGCACCAGCCCCCCATCCCGAAAGCTTTTCAAGAAGGAGGAGCCCATGCTGTTGCTAGGA
GACCCCTCTGCCTCCCTGACGCTGCTCTCCCTCTCCTCCATCTCCGAGTGCAACTCCACACGCTCCCTGC
TGCGCTCCGACAGCGATGAAATTGTCGTGTATGAGATGCCAGTCAGCCCAGTCGAGGCCCCTCCCCTGAG
TCCATGTACCCACAACCCCCTGGTCAATGTCCGAGTAGAGCGCTTCAAACGAGATCCTAACCAATCTCTG
ACTCCCACCCATGTCACCCTCACCACCCCCTCGCAGCCCAGCAGTCACCGGCGGACTCCTTCTGATGGGG
CCCTTAAGCCAGAGACTCTCCTAGCCAGCAGGAGCCCCTCCAGCAATGGGTTGAGCCCCAGTCCTGGAGC
AGGAATGTTGAAAACCCCCAGTCCCAGCCGAGACCCAGGTGAATTCCCCCGTCTCCCTGACCCCAATGTG
GTCTTCCCCCCAACCCCAAGGCGCTGGAACACTCAGCAGGACTCTACCTTGGAGAGACCCAAGACTCTGG
AGTTTCTGCCTCGGCCGCGTCCTTCTGCCAACCGGCAACGGCTGGACCCTTGGTGGTTTGTGTCCCCCAG
CCATGCCCGCAGCACCTCCCCAGCCAACAGCTCCAGCACAGAGACGCCCAGCAACCTGGACTCCTGCTTT
GCTAGCAGTAGCAGCACTGTAGAGGAGCGGCCTGGACTTCCAGCCCTGCTCCCGTTCCAGGCAGGGCCGC
TGCCCCCGACTGAGCGGACGCTCCTGGACCTGGATGCAGAGGGGCAGAGTCAGGACAGCACCGTGCCGCT
GTGCAGAGCGGAACTGAACACACACAGGCCTGCCCCTTATGAGATCCAGCAGGAGTTCTGGTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215441 representing NM_033141
Red=Cloning site Green=Tags(s)

MEPSRALLGCLASAAAAAPPGEDGAGAGAEEEEEEEEEAAAAVGPGELGCDAPLPYWTAVFEYEAAGEDE
LTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPGGEDPSCYPPIQLLEID
FAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDISQTIENVRQEAKLFAMLKHPNIIALRGVC
LKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKV
ENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFR
GIDGLAVAYGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFH
CLQDNWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNIIIHQ
LCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSLINSRSSPPASPTIIPRLR
AIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWGPGTLGQKELASGDEGSPQRREKANGLSTPS
ESPHFHLGLKSLVDGYKQWSSSAPNLVKGPRSSPALPGFTSLMEMALLAASWVVPIDIEEDEDSEGPGSG
ESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIHEEPTPVNSATSTPQLTPTNSLKRGGAHHRRCEVALLGC
GAVLAATGLGFDLLEAGKCQLLPLEEPEPPAREEKKRREGLFQRSSRPRRSTSPPSRKLFKKEEPMLLLG
DPSASLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPVEAPPLSPCTHNPLVNVRVERFKRDPNQSL
TPTHVTLTTPSQPSSHRRTPSDGALKPETLLASRSPSSNGLSPSPGAGMLKTPSPSRDPGEFPRLPDPNV
VFPPTPRRWNTQQDSTLERPKTLEFLPRPRPSANRQRLDPWWFVSPSHARSTSPANSSSTETPSNLDSCF
ASSSSTVEERPGLPALLPFQAGPLPPTERTLLDLDAEGQSQDSTVPLCRAELNTHRPAPYEIQQEFWS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_033141
ORF Size 3354 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_033141.4
RefSeq Size 5602 bp
RefSeq ORF 3357 bp
Locus ID 4293
UniProt ID P80192
Cytogenetics 14q24.2
Protein Families Druggable Genome, Protein Kinase
MW 123.2 kDa
Gene Summary Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Plays an important role in the cascades of cellular responses evoked by changes in the environment. Once activated, acts as an upstream activator of the MKK/JNK signal transduction cascade through the phosphorylation of MAP2K4/MKK4 and MAP2K7/MKK7 which in turn activate the JNKs. The MKK/JNK signaling pathway regulates stress response via activator protein-1 (JUN) and GATA4 transcription factors. Plays also a role in mitochondrial death signaling pathway, including the release cytochrome c, leading to apoptosis.[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.