Syntenin (SDCBP) (NM_005625) Human Tagged ORF Clone

CAT#: RC215390

SDCBP (Myc-DDK-tagged)-Human syndecan binding protein (syntenin) (SDCBP), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_005625" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


SDCBP (Syntenin) mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)
    • 100 ul

USD 478.00

Other products for "Syntenin"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol Syntenin
Synonyms MDA-9; MDA9; ST1; SYCL; TACIP18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215390 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTCTATCCATCTCTCGAAGACTTGAAGGTAGACAAAGTAATTCAGGCTCAAACTGCTTTTTCTG
CAAACCCTGCCAATCCAGCAATTTTGTCAGAAGCTTCTGCTCCTATCCCTCACGATGGAAATCTCTATCC
CAGACTGTATCCAGAGCTCTCTCAATACATGGGGCTGAGTTTAAATGAAGAAGAAATACGTGCAAATGTG
GCCGTGGTTTCTGGTGCACCACTTCAGGGGCAGTTGGTAGCAAGACCTTCCAGTATAAACTATATGGTGG
CTCCTGTAACTGGTAATGATGTTGGAATTCGTAGAGCAGAAATTAAGCAAGGGATTCGTGAAGTCATTTT
GTGTAAGGATCAAGATGGAAAAATTGGACTCAGGCTTAAATCAATAGATAATGGTATATTTGTTCAGCTA
GTCCAGGCTAATTCTCCAGCCTCATTGGTTGGTCTGAGATTTGGGGACCAAGTACTTCAGATCAATGGTG
AAAACTGTGCAGGATGGAGCTCTGATAAAGCGCACAAGGTGCTCAAACAGGCTTTTGGAGAGAAGATTAC
CATGACCATTCGTGACAGGCCCTTTGAACGGACGATTACCATGCATAAGGATAGCACTGGACATGTTGGT
TTTATCTTTAAAAATGGAAAAATAACATCCATAGTGAAAGATAGCTCTGCAGCCAGAAATGGTCTTCTCA
CGGAACATAACATCTGTGAAATCAATGGACAGAATGTCATTGGATTGAAGGACTCTCAAATTGCAGACAT
ACTGTCAACATCTGGGACTGTAGTTACTATTACAATCATGCCTGCTTTTATCTTTGAACATATTATTAAG
CGGATGGCACCAAGCATTATGAAAAGCCTAATGGACCACACCATTCCTGAGGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215390 protein sequence
Red=Cloning site Green=Tags(s)

MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANV
AVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQL
VQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVG
FIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIK
RMAPSIMKSLMDHTIPEV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005625
ORF Size 894 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_005625.4
RefSeq Size 2173 bp
RefSeq ORF 897 bp
Locus ID 6386
UniProt ID O00560
Cytogenetics 8q12.1
Domains PDZ
Protein Families Druggable Genome, Transmembrane
MW 32.4 kDa
Gene Summary The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Jan 2017]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.