HDAC7 (NM_015401) Human Tagged ORF Clone

CAT#: RC215233

HDAC7 (Myc-DDK-tagged)-Human histone deacetylase 7 (HDAC7), transcript variant 1

Change vector?

  • TrueORF®

USD 1,515


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HDAC7 (NM_015401) Human Tagged ORF Clone
Symbol HDAC7
Synonyms HD7A; HDAC7A
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC215233 representing NM_015401
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACAGCCCCGGCGCTGATGGGACCCAGGTGAGCCCGGGTGCCCACTACTGCAGCCCCACTGGCGCAG
GCTGCCCCAGGCCCTGTGCAGACACACCAGGCCCTCAGCCGCAGCCCATGGACCTGCGGGTGGGCCAGCG
GCCCCCAGTGGAGCCCCCACCAGAGCCCACATTGCTGGCCCTGCAGCGTCCCCAGCGCCTGCACCACCAC
CTCTTCCTAGCAGGCCTGCAGCAGCAGCGCTCGGTGGAGCCCATGAGGCTCTCCATGGACACGCCGATGC
CCGAGTTGCAGGTGGGACCCCAGGAACAAGAGCTGCGGCAGCTTCTCCACAAGGACAAGAGCAAGCGAAG
TGCTGTAGCCAGCAGCGTGGTCAAGCAGAAGCTAGCGGAGGTGATTCTGAAAAAACAGCAGGCGGCCCTA
GAAAGAACAGTCCATCCCAACAGCCCCGGCATTCCCTACAGAACCCTGGAGCCCCTGGAGACGGAAGGAG
CCACCCGCTCCATGCTCAGCAGCTTTTTGCCTCCTGTTCCCAGCCTGCCCAGTGACCCCCCAGAGCACTT
CCCTCTGCGCAAGACAGTCTCTGAGCCCAACCTGAAGCTGCGCTATAAGCCCAAGAAGTCCCTGGAGCGG
AGGAAGAATCCACTGCTCCGAAAGGAGAGTGCGCCCCCCAGCCTCCGGCGGCGGCCCGCAGAGACCCTCG
GAGACTCCTCCCCAAGTAGTAGCAGCACGCCCGCATCAGGGTGCAGCTCCCCCAATGACAGCGAGCACGG
CCCCAATCCCATCCTGGGCTCGGAGGCGCTCTTGGGCCAGCGGCTGCGGCTGCAGGAGACTTCTGTGGCC
CCGTTCGCCTTGCCGACAGTGTCCTTGCTGCCCGCAATCACTCTGGGGCTGCCCGCCCCTGCCAGGGCTG
ACAGTGACCGCAGGACCCATCCGACTCTGGGCCCTCGGGGGCCAATCCTGGGGAGCCCCCACACTCCCCT
CTTCCTGCCCCATGGCTTGGAGCCCGAGGCTGGGGGCACCTTGCCCTCTCGCCTGCAGCCCATTCTCCTC
CTGGACCCCTCAGGCTCTCATGCCCCGCTGCTGACTGTGCCCGGGCTTGGGCCCTTGCCCTTCCACTTTG
CCCAGTCCTTAATGACCACCGAGCGGCTCTCTGGGTCAGGCCTCCACTGGCCACTGAGCCGGACTCGCTC
AGAGCCCCTGCCCCCCAGTGCCACCGCTCCCCCACCGCCGGGCCCCATGCAGCCCCGCCTGGAGCAGCTC
AAAACTCACGTCCAGGTGATCAAGAGGTCAGCCAAGCCGAGTGAGAAGCCCCGGCTGCGGCAGATACCCT
CGGCTGAAGACCTGGAGACAGATGGCGGGGGACCGGGCCAGGTGGTGGACGATGGCCTGGAGCACAGGGA
GCTGGGCCATGGGCAGCCTGAGGCCAGAGGCCCCGCTCCTCTCCAGCAGCACCCTCAGGTGTTGCTCTGG
GAACAGCAGCGACTGGCTGGGCGGCTCCCCCGGGGCAGCACCGGGGACACTGTGCTGCTTCCTCTGGCCC
AGGGTGGGCACCGGCCTCTGTCCCGGGCTCAGTCTTCCCCAGCCGCACCTGCCTCACTGTCAGCCCCAGA
GCCTGCCAGCCAGGCCCGAGTCCTCTCCAGCTCAGAGACCCCTGCCAGGACCCTGCCCTTCACCACAGGG
CTGATCTATGACTCGGTCATGCTGAAGCACCAGTGCTCCTGCGGTGACAACAGCAGGCACCCGGAGCACG
CCGGCCGCATCCAGAGCATCTGGTCCCGGCTGCAGGAGCGGGGGCTCCGGAGCCAGTGTGAGTGTCTCCG
AGGCCGGAAGGCCTCCCTGGAAGAGCTGCAGTCGGTCCACTCTGAGCGGCACGTGCTCCTCTACGGCACC
AACCCGCTCAGCCGCCTCAAACTGGACAACGGGAAGCTGGCAGGGCTCCTGGCACAGCGGATGTTTGTGA
TGCTGCCCTGTGGTGGGGTTGGGGTGGACACTGACACCATCTGGAATGAGCTTCATTCCTCCAATGCAGC
CCGCTGGGCCGCTGGCAGTGTCACTGACCTCGCCTTCAAAGTGGCTTCTCGTGAGCTAAAGAATGGTTTC
GCTGTGGTGCGGCCCCCAGGACACCATGCAGATCATTCAACAGCCATGGGCTTCTGCTTCTTCAACTCAG
TGGCCATCGCCTGCCGGCAGCTGCAACAGCAGAGCAAGGCCAGCAAGATCCTCATTGTAGACTGGGACGT
GCACCATGGCAACGGCACCCAGCAAACCTTCTACCAAGACCCCAGTGTGCTCTACATCTCCCTGCATCGC
CATGACGACGGCAACTTCTTCCCGGGGAGTGGGGCTGTGGATGAGGTAGGGGCTGGCAGCGGTGAGGGCT
TCAATGTCAATGTGGCCTGGGCTGGAGGTCTGGACCCCCCCATGGGGGATCCTGAGTACCTGGCTGCTTT
CAGGATAGTCGTGATGCCCATCGCCCGAGAGTTCTCTCCAGACCTAGTCCTGGTGTCTGCTGGATTTGAT
GCTGCTGAGGGTCACCCGGCCCCACTGGGTGGCTACCATGTTTCTGCCAAATGTTTTGGATACATGACGC
AGCAACTGATGAACCTGGCAGGAGGCGCAGTGGTGCTGGCCTTGGAGGGTGGCCATGACCTCACAGCCAT
CTGTGACGCCTCTGAGGCCTGTGTGGCTGCTCTTCTGGGTAACAGGGTGGATCCCCTTTCAGAAGAAGGC
TGGAAACAGAAACCCAACCTCAATGCCATCCGCTCTCTGGAGGCCGTGATCCGGGTGCACAGTAAATACT
GGGGCTGCATGCAGCGCCTGGCCTCCTGTCCAGACTCCTGGGTGCCTAGAGTGCCAGGGGCTGACAAAGA
AGAAGTGGAGGCAGTGACCGCACTGGCGTCCCTCTCTGTGGGCATCCTGGCTGAAGATAGGCCCTCGGAG
CAGCTGGTGGAGGAGGAAGAACCTATGAATCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215233 representing NM_015401
Red=Cloning site Green=Tags(s)

MHSPGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPMDLRVGQRPPVEPPPEPTLLALQRPQRLHHH
LFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAAL
ERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLER
RKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSVA
PFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGGTLPSRLQPILL
LDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEPLPPSATAPPPPGPMQPRLEQL
KTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVVDDGLEHRELGHGQPEARGPAPLQQHPQVLLW
EQQRLAGRLPRGSTGDTVLLPLAQGGHRPLSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTG
LIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGT
NPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGF
AVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQDPSVLYISLHR
HDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFD
AAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALEGGHDLTAICDASEACVAALLGNRVDPLSEEG
WKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSE
QLVEEEEPMNL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015401
ORF Size 2973 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015401.3, NM_015401.4, NP_056216
RefSeq Size 4301
RefSeq ORF 2976
Locus ID 51564
Cytogenetics 12q13.11
Domains Hist_deacetyl
Protein Families Transcription Factors, Druggable Genome
MW 106.6 kDa
Gene Summary Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to mouse HDAC7 gene whose protein promotes repression mediated via the transcriptional corepressor SMRT. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations