RAB41 (NM_001032726) Human Tagged ORF Clone

CAT#: RC214913

RAB41 (Myc-DDK-tagged)-Human RAB41, member RAS oncogene family (RAB41)

Product Images

Circular map for RC214913

• 

  Western blot validation of overexpression lysate (Cat# LY422331) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC214913 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RAB41
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC214913 representing NM_001032726
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCTGCCTTTGGTCACGACGAGGCCTGGATGGAGGCCGGAGGCTTTGGTCTGGAGGCTGCCGAAAGAA
  CGGAATACCAGTCTCTGTGCAAATCTAAACTCTTATTCCTGGGAGAGCAGAGCGGGAAGACATCCATCAT
  CAGCCGCTTCATGTACAACAGCTTCGGCTGCGCCTGCCAGGCAACTGTTGGAATTGACTTCTTGTCTAAG
  ACCATGTACTTGGAGGACCAAATAGTTCAGCTGCAGCTATGGGACACAGCTGGCCAGGAGCGCTTTCACA
  GCCTAATTCCTAGCTACATTCGTGATTCAACTATTGCAGTGGTTGTCTATGACATTACAAACATCAATTC
  TTTTAAGGAGACAGATAAGTGGGTAGAACACGTGCGAGCAGAAAGAGGTGACGATGTTGTCATCATGTTG
  TTGGGTAACAAGATTGATTTGGATAACAAAAGACAAGTCACTGCAGAACAGGGTGAAGAAAAATCCAGAA
  ACCTCAATGTGATGTTTATTGAGACCAGTGCCAAAACCGGTTACAACGTGAAAAAGCTGTTCCGGCGTGT
  GGCTTCTGCCCTTCTTTCCACAAGGACTTCACCTCCACCAAAAGAGGGGACGGTTGAAATCGAACTGGAA
  TCCTTCGAGGAGTCAGGCAACAGAAGCTATTGT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC214913 representing NM_001032726
  Red=Cloning site Green=Tags(s)
  
  MSAFGHDEAWMEAGGFGLEAAERTEYQSLCKSKLLFLGEQSGKTSIISRFMYNSFGCACQATVGIDFLSK
  TMYLEDQIVQLQLWDTAGQERFHSLIPSYIRDSTIAVVVYDITNINSFKETDKWVEHVRAERGDDVVIML
  LGNKIDLDNKRQVTAEQGEEKSRNLNVMFIETSAKTGYNVKKLFRRVASALLSTRTSPPPKEGTVEIELE
  SFEESGNRSYC
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001032726
• ORF Size: 2537 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001032726.3
• RefSeq Size: 1028 bp
• RefSeq ORF: 666 bp
• Locus ID: 347517
• UniProt ID: Q5JT25
• Cytogenetics: Xq13.1
• Protein Families: Druggable Genome
• MW: 24.9 kDa
• Gene Summary: This gene encodes a small GTP-binding protein that belongs to the largest family within the Ras superfamily. These proteins function as regulators of membrane trafficking. They cycle between inactive GDP-bound and activated GTP-bound states, which is controlled by GTP hydrolysis-activating proteins (GAPs). This family member can be activated by the GAP protein RN-Tre, and it is localized to the Golgi complex. [provided by RefSeq, May 2010]