Gelsolin (GSN) (NM_000177) Human Tagged ORF Clone

CAT#: RC214871

Reviews ()
Write a review

GSN (Myc-DDK-tagged)-Human gelsolin (GSN), transcript variant 1



Reconstitution Protocol

USD 1,074.00

In Stock*

Size
    • 10 ug

Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GSN
Synonyms ADF; AGEL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214871 representing NM_000177
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCGCACCGCCCCGCGCCCGCGCTGCTTTGCGCGCTGTCCCTGGCGCTGTGCGCGCTGTCGCTGC
CCGTCCGCGCGGCCACTGCGTCGCGGGGGGCGTCCCAGGCGGGGGCGCCCCAGGGGCGGGTGCCCGAGGC
GCGGCCCAACAGCATGGTGGTGGAACACCCCGAGTTCCTCAAGGCAGGGAAGGAGCCTGGCCTGCAGATC
TGGCGTGTGGAGAAGTTCGATCTGGTGCCCGTGCCCACCAACCTTTATGGAGACTTCTTCACGGGCGACG
CCTACGTCATCCTGAAGACAGTGCAGCTGAGGAACGGAAATCTGCAGTATGACCTCCACTACTGGCTGGG
CAATGAGTGCAGCCAGGATGAGAGCGGGGCGGCCGCCATCTTTACCGTGCAGCTGGATGACTACCTGAAC
GGCCGGGCCGTGCAGCACCGTGAGGTCCAGGGCTTCGAGTCGGCCACCTTCCTAGGCTACTTCAAGTCTG
GCCTGAAGTACAAGAAAGGAGGTGTGGCATCAGGATTCAAGCACGTGGTACCCAACGAGGTGGTGGTGCA
GAGACTCTTCCAGGTCAAAGGGCGGCGTGTGGTCCGTGCCACCGAGGTACCTGTGTCCTGGGAGAGCTTC
AACAATGGCGACTGCTTCATCCTGGACCTGGGCAACAACATCCACCAGTGGTGTGGTTCCAACAGCAATC
GGTATGAAAGACTGAAGGCCACACAGGTGTCCAAGGGCATCCGGGACAACGAGCGGAGTGGCCGGGCCCG
AGTGCACGTGTCTGAGGAGGGCACTGAGCCCGAGGCGATGCTCCAGGTGCTGGGCCCCAAGCCGGCTCTG
CCTGCAGGTACCGAGGACACCGCCAAGGAGGATGCGGCCAACCGCAAGCTGGCCAAGCTCTACAAGGTCT
CCAATGGTGCAGGGACCATGTCCGTCTCCCTCGTGGCTGATGAGAACCCCTTCGCCCAGGGGGCCCTGAA
GTCAGAGGACTGCTTCATCCTGGACCACGGCAAAGATGGGAAAATCTTTGTCTGGAAAGGCAAGCAGGCA
AACACGGAGGAGAGGAAGGCTGCCCTCAAAACAGCCTCTGACTTCATCACCAAGATGGACTACCCCAAGC
AGACTCAGGTCTCGGTCCTTCCTGAGGGCGGTGAGACCCCACTGTTCAAGCAGTTCTTCAAGAACTGGCG
GGACCCAGACCAGACAGATGGCCTGGGCTTGTCCTACCTTTCCAGCCATATCGCCAACGTGGAGCGGGTG
CCCTTCGACGCCGCCACCCTGCACACCTCCACTGCCATGGCCGCCCAGCACGGCATGGATGACGATGGCA
CAGGCCAGAAACAGATCTGGAGAATCGAAGGTTCCAACAAGGTGCCCGTGGACCCTGCCACATATGGACA
GTTCTATGGAGGCGACAGCTACATCATTCTGTACAACTACCGCCATGGTGGCCGCCAGGGGCAGATAATC
TATAACTGGCAGGGTGCCCAGTCTACCCAGGATGAGGTCGCTGCATCTGCCATCCTGACTGCTCAGCTGG
ATGAGGAGCTGGGAGGTACCCCTGTCCAGAGCCGTGTGGTCCAAGGCAAGGAGCCCGCCCACCTCATGAG
CCTGTTTGGTGGGAAGCCCATGATCATCTACAAGGGCGGCACCTCCCGCGAGGGCGGGCAGACAGCCCCT
GCCAGCACCCGCCTCTTCCAGGTCCGCGCCAACAGCGCTGGAGCCACCCGGGCTGTTGAGGTATTGCCTA
AGGCTGGTGCACTGAACTCCAACGATGCCTTTGTTCTGAAAACCCCCTCAGCCGCCTACCTGTGGGTGGG
TACAGGAGCCAGCGAGGCAGAGAAGACGGGGGCCCAGGAGCTGCTCAGGGTGCTGCGGGCCCAACCTGTG
CAGGTGGCAGAAGGCAGCGAGCCAGATGGCTTCTGGGAGGCCCTGGGCGGGAAGGCTGCCTACCGCACAT
CCCCACGGCTGAAGGACAAGAAGATGGATGCCCATCCTCCTCGCCTCTTTGCCTGCTCCAACAAGATTGG
ACGTTTTGTGATCGAAGAGGTTCCTGGTGAGCTCATGCAGGAAGACCTGGCAACGGATGACGTCATGCTT
CTGGACACCTGGGACCAGGTCTTTGTCTGGGTTGGAAAGGATTCTCAAGAAGAAGAAAAGACAGAAGCCT
TGACTTCTGCTAAGCGGTACATCGAGACGGACCCAGCCAATCGGGATCGGCGGACGCCCATCACCGTGGT
GAAGCAAGGCTTTGAGCCTCCCTCCTTTGTGGGCTGGTTCCTTGGCTGGGATGATGATTACTGGTCTGTG
GACCCCTTGGACAGGGCCATGGCTGAGCTGGCTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214871 representing NM_000177
Red=Cloning site Green=Tags(s)

MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQI
WRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLN
GRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESF
NNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPAL
PAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQA
NTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV
PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQII
YNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAP
ASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPV
QVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVML
LDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSV
DPLDRAMAELAA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000177
ORF Size 2346 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000177.5
RefSeq Size 2705 bp
RefSeq ORF 2349 bp
Locus ID 2934
UniProt ID P06396
Cytogenetics 9q33.2
Domains GEL, Gelsolin
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton
MW 85.7 kDa
Gene Summary The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.