Thrombospondin 1 (THBS1) (NM_003246) Human Tagged ORF Clone

CAT#: RC214802

Reviews ()
Write a review

THBS1 (Myc-DDK-tagged)-Human thrombospondin 1 (THBS1)



  "NM_003246" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 680.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol THBS1
Synonyms THBS; THBS-1; TSP; TSP-1; TSP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214802 representing NM_003246
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTGGCCTGGGGACTAGGCGTCCTGTTCCTGATGCATGTGTGTGGCACCAACCGCATTCCAGAGT
CTGGCGGAGACAACAGCGTGTTTGACATCTTTGAACTCACCGGGGCCGCCCGCAAGGGGTCTGGGCGCCG
ACTGGTGAAGGGCCCCGACCCTTCCAGCCCAGCTTTCCGCATCGAGGATGCCAACCTGATCCCCCCTGTG
CCTGATGACAAGTTCCAAGACCTGGTGGATGCTGTGCGGGCAGAAAAGGGTTTCCTCCTTCTGGCATCCC
TGAGGCAGATGAAGAAGACCCGGGGCACGCTGCTGGCCCTGGAGCGGAAAGACCACTCTGGCCAGGTCTT
CAGCGTGGTGTCCAATGGCAAGGCGGGCACCCTGGACCTCAGCCTGACCGTCCAAGGAAAGCAGCACGTG
GTGTCTGTGGAAGAAGCTCTCCTGGCAACCGGCCAGTGGAAGAGCATCACCCTGTTTGTGCAGGAAGACA
GGGCCCAGCTGTACATCGACTGTGAAAAGATGGAGAATGCTGAGTTGGACGTCCCCATCCAAAGCGTCTT
CACCAGAGACCTGGCCAGCATCGCCAGACTCCGCATCGCAAAGGGGGGCGTCAATGACAATTTCCAGGGG
GTGCTGCAGAATGTGAGGTTTGTCTTTGGAACCACACCAGAAGACATCCTCAGGAACAAAGGCTGCTCCA
GCTCTACCAGTGTCCTCCTCACCCTTGACAACAACGTGGTGAATGGTTCCAGCCCTGCCATCCGCACTAA
CTACATTGGCCACAAGACAAAGGACTTGCAAGCCATCTGCGGCATCTCCTGTGATGAGCTGTCCAGCATG
GTCCTGGAACTCAGGGGCCTGCGCACCATTGTGACCACGCTGCAGGACAGCATCCGCAAAGTGACTGAAG
AGAACAAAGAGTTGGCCAATGAGCTGAGGCGGCCTCCCCTATGCTATCACAACGGAGTTCAGTACAGAAA
TAACGAGGAATGGACTGTTGATAGCTGCACTGAGTGTCACTGTCAGAACTCAGTTACCATCTGCAAAAAG
GTGTCCTGCCCCATCATGCCCTGCTCCAATGCCACAGTTCCTGATGGAGAATGCTGTCCTCGCTGTTGGC
CCAGCGACTCTGCGGACGATGGCTGGTCTCCATGGTCCGAGTGGACCTCCTGTTCTACGAGCTGTGGCAA
TGGAATTCAGCAGCGCGGCCGCTCCTGCGATAGCCTCAACAACCGATGTGAGGGCTCCTCGGTCCAGACA
CGGACCTGCCACATTCAGGAGTGTGACAAGAGATTTAAACAGGATGGTGGCTGGAGCCACTGGTCCCCGT
GGTCATCTTGTTCTGTGACATGTGGTGATGGTGTGATCACAAGGATCCGGCTCTGCAACTCTCCCAGCCC
CCAGATGAACGGGAAACCCTGTGAAGGCGAAGCGCGGGAGACCAAAGCCTGCAAGAAAGACGCCTGCCCC
ATCAATGGAGGCTGGGGTCCTTGGTCACCATGGGACATCTGTTCTGTCACCTGTGGAGGAGGGGTACAGA
AACGTAGTCGTCTCTGCAACAACCCCACACCCCAGTTTGGAGGCAAGGACTGCGTTGGTGATGTAACAGA
AAACCAGATCTGCAACAAGCAGGACTGTCCAATTGATGGATGCCTGTCCAATCCCTGCTTTGCCGGCGTG
AAGTGTACTAGCTACCCTGATGGCAGCTGGAAATGTGGTGCTTGTCCCCCTGGTTACAGTGGAAATGGCA
TCCAGTGCACAGATGTTGATGAGTGCAAAGAAGTGCCTGATGCCTGCTTCAACCACAATGGAGAGCACCG
GTGTGAGAACACGGACCCCGGCTACAACTGCCTGCCCTGCCCCCCACGCTTCACCGGCTCACAGCCCTTC
GGCCAGGGTGTCGAACATGCCACGGCCAACAAACAGGTGTGCAAGCCCCGTAACCCCTGCACGGATGGGA
CCCACGACTGCAACAAGAACGCCAAGTGCAACTACCTGGGCCACTATAGCGACCCCATGTACCGCTGCGA
GTGCAAGCCTGGCTACGCTGGCAATGGCATCATCTGCGGGGAGGACACAGACCTGGATGGCTGGCCCAAT
GAGAACCTGGTGTGCGTGGCCAATGCGACTTACCACTGCAAAAAGGATAATTGCCCCAACCTTCCCAACT
CAGGGCAGGAAGACTATGACAAGGATGGAATTGGTGATGCCTGTGATGATGACGATGACAATGATAAAAT
TCCAGATGACAGGGACAACTGTCCATTCCATTACAACCCAGCTCAGTATGACTATGACAGAGATGATGTG
GGAGACCGCTGTGACAACTGTCCCTACAACCACAACCCAGATCAGGCAGACACAGACAACAATGGGGAAG
GAGACGCCTGTGCTGCAGACATTGATGGAGACGGTATCCTCAATGAACGGGACAACTGCCAGTACGTCTA
CAATGTGGACCAGAGAGACACTGATATGGATGGGGTTGGAGATCAGTGTGACAATTGCCCCTTGGAACAC
AATCCGGATCAGCTGGACTCTGACTCAGACCGCATTGGAGATACCTGTGACAACAATCAGGATATTGATG
AAGATGGCCACCAGAACAATCTGGACAACTGTCCCTATGTGCCCAATGCCAACCAGGCTGACCATGACAA
AGATGGCAAGGGAGATGCCTGTGACCACGATGATGACAACGATGGCATTCCTGATGACAAGGACAACTGC
AGACTCGTGCCCAATCCCGACCAGAAGGACTCTGACGGCGATGGTCGAGGTGATGCCTGCAAAGATGATT
TTGACCATGACAGTGTGCCAGACATCGATGACATCTGTCCTGAGAATGTTGACATCAGTGAGACCGATTT
CCGCCGATTCCAGATGATTCCTCTGGACCCCAAAGGGACATCCCAAAATGACCCTAACTGGGTTGTACGC
CATCAGGGTAAAGAACTCGTCCAGACTGTCAACTGTGATCCTGGACTCGCTGTAGGTTATGATGAGTTTA
ATGCTGTGGACTTCAGTGGCACCTTCTTCATCAACACCGAAAGGGACGATGACTATGCTGGATTTGTCTT
TGGCTACCAGTCCAGCAGCCGCTTTTATGTTGTGATGTGGAAGCAAGTCACCCAGTCCTACTGGGACACC
AACCCCACGAGGGCTCAGGGATACTCGGGCCTTTCTGTGAAAGTTGTAAACTCCACCACAGGGCCTGGCG
AGCACCTGCGGAACGCCCTGTGGCACACAGGAAACACCCCTGGCCAGGTGCGCACCCTGTGGCATGACCC
TCGTCACATAGGCTGGAAAGATTTCACCGCCTACAGATGGCGTCTCAGCCACAGGCCAAAGACGGGTTTC
ATTAGAGTGGTGATGTATGAAGGGAAGAAAATCATGGCTGACTCAGGACCCATCTATGATAAAACCTATG
CTGGTGGTAGACTAGGGTTGTTTGTCTTCTCTCAAGAAATGGTGTTCTTCTCTGACCTGAAATACGAATG
TAGAGATCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214802 representing NM_003246
Red=Cloning site Green=Tags(s)

MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPV
PDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHV
VSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQG
VLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSM
VLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKK
VSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACP
INGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGV
KCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQPF
GQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPN
ENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDV
GDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNC
RLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVR
HQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDT
NPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGF
IRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003246
ORF Size 3510 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003246.4
RefSeq Size 5820 bp
RefSeq ORF 3513 bp
Locus ID 7057
UniProt ID P07996
Cytogenetics 15q14
Domains tsp_1, VWC, EGF_CA, TSPN, tsp_3, EGF, EGF
Protein Families Druggable Genome
Protein Pathways Bladder cancer, ECM-receptor interaction, Focal adhesion, p53 signaling pathway, TGF-beta signaling pathway
MW 129.38 kDa
Gene Summary The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "THBS1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


Rabbit Polyclonal Anti-THBS1 Antibody
    • 100 ul

USD 380.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.