RNF5 (NM_006913) Human Tagged ORF Clone

CAT#: RC214615

RNF5 (Myc-DDK-tagged)-Human ring finger protein 5 (RNF5)

Product Images

Circular map for RC214615

• 

  Western blot validation of overexpression lysate (Cat# LY402057) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC214615 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RNF5
• Synonyms: RING5; RMA1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC214615 representing NM_006913
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCAGCAGCGGAGGAGGAGGACGGGGGCCCCGAAGGGCCAAATCGCGAGCGGGGCGGGGCGGGCGCGA
  CCTTCGAATGTAATATATGTTTGGAGACTGCTCGGGAAGCTGTGGTCAGTGTGTGTGGCCACCTGTACTG
  TTGGCCATGTCTTCATCAGTGGCTGGAGACACGGCCAGAACGGCAAGAGTGTCCAGTATGTAAAGCTGGG
  ATCAGCAGAGAGAAGGTTGTCCCGCTTTATGGGCGAGGGAGCCAGAAGCCCCAGGATCCCAGATTAAAAA
  CTCCACCCCGCCCCCAGGGCCAGAGACCAGCTCCGGAGAGCAGAGGGGGATTCCAGCCATTTGGTGATAC
  CGGGGGCTTCCACTTCTCATTTGGTGTTGGTGCTTTTCCCTTTGGCTTTTTCACCACCGTCTTCAATGCC
  CATGAGCCTTTCCGCCGGGGTACAGGTGTGGATCTGGGACAGGGTCACCCAGCCTCCAGCTGGCAGGATT
  CCCTCTTCCTGTTTCTCGCCATCTTCTTCTTTTTTTGGCTGCTCAGTATT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC214615 representing NM_006913
  Red=Cloning site Green=Tags(s)
  
  MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAG
  ISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNA
  HEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_006913
• ORF Size: 540 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_006913.4
• RefSeq Size: 1179 bp
• RefSeq ORF: 543 bp
• Locus ID: 6048
• UniProt ID: Q99942
• Cytogenetics: 6p21.32
• Domains: RING
• Protein Families: Transmembrane
• MW: 19.7 kDa
• Gene Summary: The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions. [provided by RefSeq, Jul 2008]