CNTN4 (NM_175612) Human Tagged ORF Clone

CAT#: RC214500

CNTN4 (Myc-DDK-tagged)-Human contactin 4 (CNTN4), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_175612" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


CNTN4 rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "CNTN4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CNTN4
Synonyms AXCAM; axonal-associated cell adhesion molecule; axonal cell adhesion molecule; BIG-2; CNTN4A; contactin 4; MGC33615; neural cell adhesion protein BIG-2; OTTHUMP00000147566; OTTHUMP00000147567
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214500 representing NM_175612
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCTGGATGCTGACAGTGCTGGCCTCAGCTGATGCCTCTAGATACGTGTTCAGGAATGAGAGCGTGC
ACCCCTTCTCTCCCTTTGAGGTTAAAGTAGGTGTCTTCAACAACAAAGGAGAAGGCCCTTTCAGTCCCAC
CACGGTGGTGTATTCTGCAGAAGAAGAACCCACCAAACCACCAGCCAGTATCTTTGCCAGAAGTCTTTCT
GCCACAGATATTGAAGTTTTCTGGGCCTCCCCACTGGAGAAGAATAGAGGACGAATACAAGGTTATGAGG
TTAAATATTGGAGACATGAAGACAAAGAAGAAAATGCTAGAAAAATACGAACAGTTGGAAATCAGACATC
AACAAAAATCACGAACTTAAAAGGCAGTGTGCTGTATCACTTAGCTGTCAAGGCATATAATTCTGCTGGG
ACAGGCCCCTCTAGTGCAACAGTCAATGTGACAACCCGAAAGCCACCACCAAGTCAACCCCCCGGAAACA
TCATATGGAATTCATCAGACTCCAAAATTATCCTGAATTGGGATCAAGTGAAGGCCCTGGATAATGAGTC
GGAAGTAAAAGGATACAAAGTCTTGTACAGATGGAACAGACAAAGCAGCACATCTGTCATTGAAACAAAT
AAAACATCGGTGGAGCTTTCTTTGCCTTTCGATGAAGATTATATAATAGAAATTAAGCCATTCAGCGACG
GAGGAGATGGCAGCAGCAGTGAACAAATTCGAATTCCAAAGATATCAAATGCCTACGCGAGAGGATCTGG
GGCTTCCACTTCGAATGCATGTACGCTGTCAGCCATCAGTACAATAATGATTTCCCTCACAGCTAGGTCC
AGTTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214500 representing NM_175612
Red=Cloning site Green=Tags(s)

MIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLS
ATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAG
TGPSSATVNVTTRKPPPSQPPGNIIWNSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETN
KTSVELSLPFDEDYIIEIKPFSDGGDGSSSEQIRIPKISNAYARGSGASTSNACTLSAISTIMISLTARS
SL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_175612
ORF Size 846 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_175612.1, NP_783301.1
RefSeq Size 3072 bp
RefSeq ORF 848 bp
Locus ID 152330
Cytogenetics 3p26.3-p26.2
Protein Families Secreted Protein
MW 29.6 kDa
Gene Summary This gene encodes a member of the contactin family of immunoglobulins. Contactins are axon-associated cell adhesion molecules that function in neuronal network formation and plasticity. The encoded protein is a glycosylphosphatidylinositol-anchored neuronal membrane protein that may play a role in the formation of axon connections in the developing nervous system. Deletion or mutation of this gene may play a role in 3p deletion syndrome and autism spectrum disorders. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.