FOG2(ZFPM2) (NM_012082) Human Tagged ORF Clone

CAT#: RC214338

ZFPM2 (Myc-DDK-tagged)-Human zinc finger protein, multitype 2 (ZFPM2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FOG2(ZFPM2) (NM_012082) Human Tagged ORF Clone
Symbol ZFPM2
Synonyms DIH3; FOG2; hFOG-2; SRXY9; ZC2HC11B; ZNF89B
Vector pCMV6-Entry
Sequence Data
>RC214338 representing NM_012082
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCGGCGAAAGCAAAGCAAACCCCGGCAGATCAAACGGCCGCTTGAAGATGCCATTGAAGATGAGG
AAGAAGAATGTCCATCAGAGGAAACAGACATCATCTCCAAAGGAGACTTTCCATTGGAGGAAAGCTTTTC
CACAGAATTTGGGCCTGAAAATCTGAGCTGCGAAGAAGTGGAATACTTTTGTAACAAAGGTGATGATGAA
GGAATCCAGGAGACAGCAGAATCAGATGGGGACACACAGTCAGAGAAACCGGGGCAACCTGGAGTTGAGA
CAGACGACTGGGATGGACCAGGAGAGCTGGAGGTGTTTCAGAAAGATGGGGAACGAAAAATTCAGAGTCG
ACAGCAACTTCCAGTGGGAACAACCTGGGGGCCGTTTCCTGGGAAGATGGACTTGAATAATAATTCTTTG
AAGACAAAGGCTCAGGTCCCAATGGTGCTGACTGCTGGTCCCAAGTGGTTGCTGGATGTGACTTGGCAAG
GAGTGGAAGACAACAAAAACAACTGCATTGTGTACAGCAAAGGGGGTCAGCTTTGGTGTACAACTACGAA
GGCCATCTCTGAGGGTGAAGAGCTAATTGCCTTTGTGGTGGATTTTGACTCAAGGCTACAAGCTGCCAGT
CAGATGACTCTCACAGAAGGGATGTACCCTGCACGCCTGCTGGACTCAATTCAGCTGCTTCCTCAGCAAG
CTGCCATGGCTTCTATTTTGCCCACAGCTATTGTCAATAAGGATATATTCCCTTGCAAGTCCTGTGGCAT
CTGGTATCGGAGTGAGCGGAATCTGCAGGCCCATTTGATGTACTACTGCAGTGGGAGGCAAAGAGAAGCT
GCTCCGGTGTCAGAGGAAAATGAAGACAGTGCCCATCAGATTTCCAGCCTGTGCCCCTTCCCACAGTGCA
CCAAGAGCTTTTCAAATGCTCGAGCTCTAGAAATGCACCTGAATTCACACAGTGGAGTGAAAATGGAAGA
ATTCCTGCCCCCTGGTGCTAGTCTAAAATGCACCGTCTGTAGCTACACTGCTGATTCCGTGATCAACTTT
CACCAACACCTGTTCTCCCATCTCACTCAAGCTGCCTTCCGATGTAATCACTGCCATTTCGGCTTCCAGA
CTCAGAGGGAGTTATTGCAGCACCAGGAGCTCCATGTCCCTAGCGGCAAACTTCCCAGAGAAAGTGACAT
GGAACACTCTCCAAGTGCAACTGAAGACAGCTTACAGCCAGCCACAGACTTATTGACCAGAAGCGAACTT
CCCCAGAGCCAAAAGGCCATGCAGACTAAAGATGCGAGCTCTGACACAGAGCTGGACAAGTGTGAGAAAA
AGACTCAGCTCTTTCTCACGAACCAGAGACCAGAGATACAGCCTACAACAAATAAACAAAGCTTTTCTTA
CACAAAAATAAAGTCTGAGCCCTCTAGCCCAAGACTTGCCTCATCTCCAGTTCAGCCTAATATTGGGCCT
TCTTTCCCTGTGGGCCCTTTCCTATCTCAGTTTTCTTTCCCCCAAGATATCACCATGGTCCCTCAAGCTT
CAGAGATCTTAGCTAAGATGTCTGAACTGGTGCATCGGCGACTGAGGCATGGCAGTAGTAGCTACCCTCC
CGTCATTTACAGCCCTTTGATGCCCAAGGGGGCTACTTGTTTTGAGTGTAACATAACATTCAATAATTTG
GATAATTATCTAGTGCACAAAAAGCATTATTGCAGCAGCCGATGGCAGCAGATGGCTAAGTCCCCAGAGT
TCCCTAGTGTGTCAGAAAAGATGCCTGAAGCTTTGAGTCCCAACACTGGCCAAACCTCCATAAACCTTCT
CAACCCAGCTGCTCATTCTGCTGATCCTGAGAATCCACTTCTTCAAACATCTTGCATCAATTCTTCCACT
GTCTTAGATTTAATTGGGCCAAATGGGAAGGGCCATGACAAGGACTTTTCCACTCAAACTAAGAAGCTCT
CCACCTCCAGTAACAATGATGACAAAATTAATGGAAAACCTGTTGATGTGAAAAATCCCAGTGTCCCCTT
AGTGGATGGGGAAAGTGACCCAAATAAGACTACCTGTGAAGCTTGCAACATTACCTTCAGCCGGCACGAA
ACATACATGGTCCACAAACAGTATTACTGTGCTACACGCCACGACCCTCCACTGAAGAGGTCTGCTTCCA
ACAAAGTGCCTGCCATGCAGAGAACCATGCGCACACGCAAGCGCAGAAAGATGTATGAGATGTGCCTACC
TGAGCAGGAACAAAGGCCTCCACTGGTTCAGCAGAGATTTCTTGACGTAGCCAACCTCAATAATCCTTGT
ACCTCCACTCAAGAACCCACAGAAGGGCTAGGAGAGTGCTACCACCCAAGATGTGATATCTTTCCAGGAA
TTGTCTCTAAACACTTGGAAACTTCTCTGACGATCAACAAGTGTGTTCCAGTTTCCAAATGTGATACTAC
TCATTCCAGTGTTTCCTGCCTAGAGATGGACGTGCCCATAGATCTCAGCAAAAAGTGTTTATCTCAGTCT
GAGCGGACGACCACGTCTCCCAAAAGGCTGCTGGACTATCACGAGTGCACTGTGTGCAAGATCAGTTTCA
ATAAGGTAGAAAACTATCTGGCCCACAAGCAGAATTTCTGCCCGGTTACTGCACATCAGCGTAATGACCT
GGGTCAACTGGACGGCAAAGTGTTTCCGAATCCAGAAAGCGAACGAAACAGCCCTGATGTCAGCTACGAA
AGAAGCATAATAAAATGTGAGAAAAATGGGAATTTGAAGCAGCCTTCCCCCAATGGAAACTTATTTTCAT
CCCACCTAGCAACCCTGCAAGGCTTGAAGGTCTTTAGTGAAGCTGCTCAGCTCATTGCTACAAAAGAAGA
AAACAGACATTTGTTTCTTCCACAATGCCTTTACCCTGGAGCAATAAAGAAAGCAAAAGGAGCCGACCAG
CTTTCTCCATATTATGGAATCAAGCCAAGTGATTATATTTCTGGTTCTCTTGTCATCCATAACACTGACA
TCGAGCAAAGCAGAAATGCAGAAAATGAATCTCCTAAAGGCCAGGCTTCCTCAAATGGGTGTGCTGCGCT
GAAGAAAGATTCTCTGCCATTGTTGCCCAAAAATCGAGGAATGGTAATAGTGAATGGTGGACTGAAACAA
GATGAGAGACCTGCTGCCAACCCACAGCAAGAGAACATTTCCCAGAATCCTCAGCACGAAGACGACCACA
AATCTCCCTCGTGGATCTCTGAGAACCCATTAGCTGCCAATGAGAATGTCTCACCAGGAATTCCCTCAGC
AGAGGAACAGTTGTCTAGTATAGCAAAAGGTGTGAATGGTTCCAGCCAGGCTCCAACCAGTGGGAAATAT
TGCCGGCTATGTGATATCCAGTTCAACAACCTTTCAAACTTTATAACTCACAAGAAGTTTTATTGCTCAT
CACATGCAGCAGAACATGTCAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214338 representing NM_012082
Red=Cloning site Green=Tags(s)

MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEVEYFCNKGDDE
GIQETAESDGDTQSEKPGQPGVETDDWDGPGELEVFQKDGERKIQSRQQLPVGTTWGPFPGKMDLNNNSL
KTKAQVPMVLTAGPKWLLDVTWQGVEDNKNNCIVYSKGGQLWCTTTKAISEGEELIAFVVDFDSRLQAAS
QMTLTEGMYPARLLDSIQLLPQQAAMASILPTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREA
APVSEENEDSAHQISSLCPFPQCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINF
HQHLFSHLTQAAFRCNHCHFGFQTQRELLQHQELHVPSGKLPRESDMEHSPSATEDSLQPATDLLTRSEL
PQSQKAMQTKDASSDTELDKCEKKTQLFLTNQRPEIQPTTNKQSFSYTKIKSEPSSPRLASSPVQPNIGP
SFPVGPFLSQFSFPQDITMVPQASEILAKMSELVHRRLRHGSSSYPPVIYSPLMPKGATCFECNITFNNL
DNYLVHKKHYCSSRWQQMAKSPEFPSVSEKMPEALSPNTGQTSINLLNPAAHSADPENPLLQTSCINSST
VLDLIGPNGKGHDKDFSTQTKKLSTSSNNDDKINGKPVDVKNPSVPLVDGESDPNKTTCEACNITFSRHE
TYMVHKQYYCATRHDPPLKRSASNKVPAMQRTMRTRKRRKMYEMCLPEQEQRPPLVQQRFLDVANLNNPC
TSTQEPTEGLGECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSSVSCLEMDVPIDLSKKCLSQS
ERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDGKVFPNPESERNSPDVSYE
RSIIKCEKNGNLKQPSPNGNLFSSHLATLQGLKVFSEAAQLIATKEENRHLFLPQCLYPGAIKKAKGADQ
LSPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQASSNGCAALKKDSLPLLPKNRGMVIVNGGLKQ
DERPAANPQQENISQNPQHEDDHKSPSWISENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKY
CRLCDIQFNNLSNFITHKKFYCSSHAAEHVK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012082
ORF Size 3453 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012082.1, NM_012082.2, NM_012082.3, NP_036214
RefSeq Size 4507
RefSeq ORF 3456
Locus ID 23414
Cytogenetics 8q23.1
Domains zf-C2H2
Protein Families Transcription Factors
MW 128 kDa
Gene Summary The zinc finger protein encoded by this gene is a widely expressed member of the FOG family of transcription factors. The family members modulate the activity of GATA family proteins, which are important regulators of hematopoiesis and cardiogenesis in mammals. It has been demonstrated that the protein can both activate and down-regulate expression of GATA-target genes, suggesting different modulation in different promoter contexts. A related mRNA suggests an alternatively spliced product but this information is not yet fully supported by the sequence. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)