KCNK2 (NM_001017424) Human Tagged ORF Clone

CAT#: RC214082

Reviews ()
Write a review

KCNK2 (Myc-DDK-tagged)-Human potassium channel, subfamily K, member 2 (KCNK2), transcript variant 1



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "KCNK2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNK2
Synonyms hTREK-1c; hTREK-1e; K2p2.1; TPKC1; TREK; TREK-1; TREK1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214082 representing NM_001017424
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGAACCCACGAGCAAAAAGGGATTTCTACTTGGCGGCACCTGACTTGCTGGATCCTAAATCTGCCG
CTCAGAACTCCAAACCGAGGCTCTCGTTTTCCACGAAACCCACAGTGCTTGCTTCCCGGGTGGAGAGTGA
CACGACCATTAATGTTATGAAATGGAAGACGGTCTCCACGATATTCCTGGTGGTTGTCCTCTATCTGATC
ATCGGAGCCACCGTGTTCAAAGCATTGGAGCAGCCTCATGAGATTTCACAGAGGACCACCATTGTGATCC
AGAAGCAAACATTCATATCCCAACATTCCTGTGTCAATTCGACGGAGCTGGATGAACTCATTCAGCAAAT
AGTGGCAGCAATAAATGCAGGGATTATACCGTTAGGAAACACCTCCAATCAAATCAGTCACTGGGATTTG
GGAAGTTCCTTCTTCTTTGCTGGCACTGTTATTACAACCATAGGATTTGGAAACATCTCACCACGCACAG
AAGGCGGCAAAATATTCTGTATCATCTATGCCTTACTGGGAATTCCCCTCTTTGGTTTTCTCTTGGCTGG
AGTTGGAGATCAGCTAGGCACCATATTTGGAAAAGGAATTGCCAAAGTGGAAGATACGTTTATTAAGTGG
AATGTTAGTCAGACCAAGATTCGCATCATCTCAACAATCATATTTATACTATTTGGCTGTGTACTCTTTG
TGGCTCTGCCTGCGATCATATTCAAACACATAGAAGGCTGGAGTGCCCTGGACGCCATTTATTTTGTGGT
TATCACTCTAACAACTATTGGATTTGGTGACTACGTTGCAGGTGGATCCGATATTGAATATCTGGACTTC
TATAAGCCTGTCGTGTGGTTCTGGATCCTTGTAGGGCTTGCTTACTTTGCTGCTGTCCTGAGCATGATTG
GAGATTGGCTCCGAGTGATATCTAAAAAGACAAAAGAAGAGGTGGGAGAGTTCAGAGCACACGCTGCTGA
GTGGACAGCCAACGTCACAGCCGAATTCAAAGAAACCAGGAGGCGACTGAGTGTGGAGATTTATGACAAG
TTCCAGCGGGCCACCTCCATCAAGCGGAAGCTCTCGGCAGAACTGGCTGGAAACCACAATCAGGAGCTGA
CTCCTTGTAGGAGGACCCTGTCAGTGAACCACCTGACCAGCGAGAGGGATGTCTTGCCTCCCTTACTGAA
GACTGAGAGTATCTATCTGAATGGTTTGACGCCACACTGTGCTGGTGAAGAGATTGCTGTGATTGAGAAC
ATCAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214082 representing NM_001017424
Red=Cloning site Green=Tags(s)

MMNPRAKRDFYLAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLI
IGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWDL
GSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKW
NVSQTKIRIISTIIFILFGCVLFVALPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDF
YKPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDK
FQRATSIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIAVIEN
IK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001017424
ORF Size 1266 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001017424.3
RefSeq Size 3340 bp
RefSeq ORF 1269 bp
Locus ID 3776
UniProt ID O95069
Cytogenetics 1q41
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 46.7 kDa
Gene Summary This gene encodes one of the members of the two-pore-domain background potassium channel protein family. This type of potassium channel is formed by two homodimers that create a channel that leaks potassium out of the cell to control resting membrane potential. The channel can be opened, however, by certain anesthetics, membrane stretching, intracellular acidosis, and heat. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.