BACH2 (NM_021813) Human Tagged ORF Clone

CAT#: RC214061

Reviews ()
Write a review

BACH2 (Myc-DDK-tagged)-Human BTB and CNC homology 1, basic leucine zipper transcription factor 2 (BACH2), transcript variant 1



  "NM_021813" in other vectors (6)

Reconstitution Protocol

USD 770.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "BACH2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BACH2
Synonyms BTBD25; IMD60
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214061 representing NM_021813
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGTGGATGAGAAGCCTGACTCCCCCATGTATGTGTATGAGTCCACAGTCCACTGCACCAACATCC
TCCTGGGCCTCAATGACCAGCGGAAAAAGGATATTCTCTGTGACGTGACTTTGATCGTGGAGAGGAAGGA
GTTCCGGGCCCACCGGGCTGTGCTGGCCGCATGCAGTGAATATTTTTGGCAGGCGCTGGTTGGACAGACA
AAAAATGATTTGGTGGTCAGCTTGCCTGAGGAGGTCACAGCCAGGGGCTTTGGGCCGCTGTTACAGTTTG
CCTACACTGCCAAGCTGTTACTCAGCAGAGAAAACATCCGCGAGGTCATCCGCTGTGCTGAGTTCCTGCG
CATGCACAACCTGGAGGACTCCTGCTTCAGCTTCCTGCAGACCCAGCTCCTGAACAGTGAGGATGGCCTG
TTTGTGTGCCGGAAGGATGCTGCGTGCCAGCGCCCACACGAGGACTGCGAGAACTCTGCAGGAGAGGAGG
AGGATGAAGAGGAGGAGACGATGGATTCAGAGACGGCCAAGATGGCTTGCCCCAGGGACCAGATGCTTCC
AGAGCCCATCAGCTTTGAGGCCGCCGCCATCCCCGTAGCAGAGAAGGAAGAAGCCCTGCTGCCCGAGCCT
GACGTGCCCACAGACACCAAGGAGAGCTCAGAAAAGGACGCGTTAACGCAGTACCCCAGATACAAGAAAT
ACCAGCTTGCATGTACCAAGAATGTCTATAATGCATCATCACACAGTACCTCAGGTTTTGCAAGCACATT
CCGGGAAGATAACTCTAGCAACAGCCTCAAGCCGGGGCTTGCCAGGGGGCAGATTAAAAGTGAGCCGCCC
AGTGAAGAGAATGAGGAAGAGAGCATCACGCTCTGCCTGTCTGGAGATGAGCCTGACGCCAAGGACAGAG
CGGGGGATGTCGAGATGGACCGGAAACAGCCCAGCCCTGCCCCTACCCCCACGGCCCCAGCTGGGGCCGC
CTGCCTGGAGAGATCCAGGAGCGTGGCCTCGCCCTCCTGCTTAAGGTCTCTGTTCAGCATAACGAAAAGT
GTGGAGCTGTCTGGCCTGCCCAGTACATCTCAGCAGCACTTTGCCAGGAGTCCAGCCTGCCCTTTTGACA
AGGGGATCACTCAGGGTGACCTTAAAACTGACTACACCCCTTTCACAGGGAATTATGGACAGCCCCACGT
GGGCCAGAAGGAGGTGTCCAACTTCACCATGGGGTCGCCCCTCAGGGGGCCTGGGTTGGAGGCTCTCTGT
AAACAGGAGGGAGAGCTGGACCGGAGGAGCGTGATCTTCTCCTCCAGCGCTTGTGACCAAGTGAGCACCT
CGGTGCATTCTTATTCTGGGGTGAGCAGTTTGGACAAAGACCTCTCTGAGCCGGTGCCAAAGGGTCTGTG
GGTGGGAGCCGGCCAGTCCCTCCCCAGCTCGCAGGCCTACTCCCACGGTGGGCTGATGGCCGACCACTTG
CCAGGAAGGATGCGGCCCAACACCAGCTGCCCGGTGCCAATCAAAGTCTGCCCTCGCTCACCCCCCTTGG
AGACCAGGACCAGGACTTCCAGCTCCTGCTCTTCCTATTCCTACGCGGAGGACGGGAGCGGGGGCTCACC
CTGCAGCCTCCCTCTCTGTGAGTTCTCCTCCTCGCCCTGTTCCCAGGGAGCCAGATTCCTTGCCACAGAA
CATCAGGAACCAGGCCTGATGGGAGATGGAATGTACAACCAAGTGCGGCCCCAAATTAAATGTGAGCAGT
CTTATGGAACCAACTCCAGTGACGAATCCGGATCGTTCTCGGAAGCAGACAGTGAGTCGTGTCCTGTGCA
GGACAGGGGCCAGGAGGTAAAACTTCCTTTTCCTGTAGATCAAATCACAGATCTTCCAAGGAACGATTTC
CAGATGATGATTAAAATGCACAAGCTAACCTCAGAACAGTTAGAGTTTATTCATGATGTCCGACGGCGCA
GCAAGAACCGCATCGCGGCCCAGCGCTGCCGCAAAAGGAAACTGGACTGTATTCAGAATTTAGAATGTGA
AATCCGCAAATTGGTGTGTGAGAAAGAGAAACTGTTGTCAGAGAGGAATCAACTGAAAGCATGCATGGGG
GAACTGTTGGACAACTTCTCCTGCCTTTCCCAGGAAGTTTGCCGAGACATCCAGAGCCCCGAGCAGATCC
AGGCCCTGCATCGGTATTGCCCTGTCCTCAGACCCATGGACTTGCCCACGGCCTCCAGTATTAACCCTGC
GCCCTTGGGTGCTGAGCAGAACATTGCGGCCTCCCAATGCGCAGTGGGGGAAAACGTGCCCTGCTGCTTG
GAGCCAGGCGCGGCTCCCCCCGGACCCCCCTGGGCACCCAGCAACACCTCCGAGAATTGTACCTCTGGGA
GGAGACTAGAAGGCACTGACCCGGGAACCTTCTCAGAGAGAGGACCTCCTCTTGAACCCAGGAGCCAAAC
AGTGACCGTGGACTTCTGCCAGGAAATGACTGATAAGTGTACAACTGACGAACAGCCCAGGAAAGATTAT
ACC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC214061 representing NM_021813
Red=Cloning site Green=Tags(s)

MSVDEKPDSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSEYFWQALVGQT
KNDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMHNLEDSCFSFLQTQLLNSEDGL
FVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEP
DVPTDTKESSEKDALTQYPRYKKYQLACTKNVYNASSHSTSGFASTFREDNSSNSLKPGLARGQIKSEPP
SEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITKS
VELSGLPSTSQQHFARSPACPFDKGITQGDLKTDYTPFTGNYGQPHVGQKEVSNFTMGSPLRGPGLEALC
KQEGELDRRSVIFSSSACDQVSTSVHSYSGVSSLDKDLSEPVPKGLWVGAGQSLPSSQAYSHGGLMADHL
PGRMRPNTSCPVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSPCSLPLCEFSSSPCSQGARFLATE
HQEPGLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFSEADSESCPVQDRGQEVKLPFPVDQITDLPRNDF
QMMIKMHKLTSEQLEFIHDVRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMG
ELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL
EPGAAPPGPPWAPSNTSENCTSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDY
T

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021813
ORF Size 2523 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021813.1, NP_068585.1
RefSeq Size 9120 bp
RefSeq ORF 2526 bp
Locus ID 60468
UniProt ID Q9BYV9
Cytogenetics 6q15
Domains BTB, BRLZ
Protein Families Druggable Genome, Transcription Factors
MW 92.4 kDa
Gene Summary Transcriptional regulator that acts as repressor or activator (By similarity). Binds to Maf recognition elements (MARE) (By similarity). Plays an important role in coordinating transcription activation and repression by MAFK (By similarity). Induces apoptosis in response to oxidative stress through repression of the antiapoptotic factor HMOX1 (PubMed:17018862). Positively regulates the nuclear import of actin (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.