BACH2 (NM_021813) Human Tagged ORF Clone

CAT#: RC214061

BACH2 (Myc-DDK-tagged)-Human BTB and CNC homology 1, basic leucine zipper transcription factor 2 (BACH2), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 1,298.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name BACH2 (NM_021813) Human Tagged ORF Clone
Symbol BACH2
Synonyms BTBD25; BTBD25
Vector pCMV6-Entry
Sequence Data
>RC214061 representing NM_021813
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGTGGATGAGAAGCCTGACTCCCCCATGTATGTGTATGAGTCCACAGTCCACTGCACCAACATCC
TCCTGGGCCTCAATGACCAGCGGAAAAAGGATATTCTCTGTGACGTGACTTTGATCGTGGAGAGGAAGGA
GTTCCGGGCCCACCGGGCTGTGCTGGCCGCATGCAGTGAATATTTTTGGCAGGCGCTGGTTGGACAGACA
AAAAATGATTTGGTGGTCAGCTTGCCTGAGGAGGTCACAGCCAGGGGCTTTGGGCCGCTGTTACAGTTTG
CCTACACTGCCAAGCTGTTACTCAGCAGAGAAAACATCCGCGAGGTCATCCGCTGTGCTGAGTTCCTGCG
CATGCACAACCTGGAGGACTCCTGCTTCAGCTTCCTGCAGACCCAGCTCCTGAACAGTGAGGATGGCCTG
TTTGTGTGCCGGAAGGATGCTGCGTGCCAGCGCCCACACGAGGACTGCGAGAACTCTGCAGGAGAGGAGG
AGGATGAAGAGGAGGAGACGATGGATTCAGAGACGGCCAAGATGGCTTGCCCCAGGGACCAGATGCTTCC
AGAGCCCATCAGCTTTGAGGCCGCCGCCATCCCCGTAGCAGAGAAGGAAGAAGCCCTGCTGCCCGAGCCT
GACGTGCCCACAGACACCAAGGAGAGCTCAGAAAAGGACGCGTTAACGCAGTACCCCAGATACAAGAAAT
ACCAGCTTGCATGTACCAAGAATGTCTATAATGCATCATCACACAGTACCTCAGGTTTTGCAAGCACATT
CCGGGAAGATAACTCTAGCAACAGCCTCAAGCCGGGGCTTGCCAGGGGGCAGATTAAAAGTGAGCCGCCC
AGTGAAGAGAATGAGGAAGAGAGCATCACGCTCTGCCTGTCTGGAGATGAGCCTGACGCCAAGGACAGAG
CGGGGGATGTCGAGATGGACCGGAAACAGCCCAGCCCTGCCCCTACCCCCACGGCCCCAGCTGGGGCCGC
CTGCCTGGAGAGATCCAGGAGCGTGGCCTCGCCCTCCTGCTTAAGGTCTCTGTTCAGCATAACGAAAAGT
GTGGAGCTGTCTGGCCTGCCCAGTACATCTCAGCAGCACTTTGCCAGGAGTCCAGCCTGCCCTTTTGACA
AGGGGATCACTCAGGGTGACCTTAAAACTGACTACACCCCTTTCACAGGGAATTATGGACAGCCCCACGT
GGGCCAGAAGGAGGTGTCCAACTTCACCATGGGGTCGCCCCTCAGGGGGCCTGGGTTGGAGGCTCTCTGT
AAACAGGAGGGAGAGCTGGACCGGAGGAGCGTGATCTTCTCCTCCAGCGCTTGTGACCAAGTGAGCACCT
CGGTGCATTCTTATTCTGGGGTGAGCAGTTTGGACAAAGACCTCTCTGAGCCGGTGCCAAAGGGTCTGTG
GGTGGGAGCCGGCCAGTCCCTCCCCAGCTCGCAGGCCTACTCCCACGGTGGGCTGATGGCCGACCACTTG
CCAGGAAGGATGCGGCCCAACACCAGCTGCCCGGTGCCAATCAAAGTCTGCCCTCGCTCACCCCCCTTGG
AGACCAGGACCAGGACTTCCAGCTCCTGCTCTTCCTATTCCTACGCGGAGGACGGGAGCGGGGGCTCACC
CTGCAGCCTCCCTCTCTGTGAGTTCTCCTCCTCGCCCTGTTCCCAGGGAGCCAGATTCCTTGCCACAGAA
CATCAGGAACCAGGCCTGATGGGAGATGGAATGTACAACCAAGTGCGGCCCCAAATTAAATGTGAGCAGT
CTTATGGAACCAACTCCAGTGACGAATCCGGATCGTTCTCGGAAGCAGACAGTGAGTCGTGTCCTGTGCA
GGACAGGGGCCAGGAGGTAAAACTTCCTTTTCCTGTAGATCAAATCACAGATCTTCCAAGGAACGATTTC
CAGATGATGATTAAAATGCACAAGCTAACCTCAGAACAGTTAGAGTTTATTCATGATGTCCGACGGCGCA
GCAAGAACCGCATCGCGGCCCAGCGCTGCCGCAAAAGGAAACTGGACTGTATTCAGAATTTAGAATGTGA
AATCCGCAAATTGGTGTGTGAGAAAGAGAAACTGTTGTCAGAGAGGAATCAACTGAAAGCATGCATGGGG
GAACTGTTGGACAACTTCTCCTGCCTTTCCCAGGAAGTTTGCCGAGACATCCAGAGCCCCGAGCAGATCC
AGGCCCTGCATCGGTATTGCCCTGTCCTCAGACCCATGGACTTGCCCACGGCCTCCAGTATTAACCCTGC
GCCCTTGGGTGCTGAGCAGAACATTGCGGCCTCCCAATGCGCAGTGGGGGAAAACGTGCCCTGCTGCTTG
GAGCCAGGCGCGGCTCCCCCCGGACCCCCCTGGGCACCCAGCAACACCTCCGAGAATTGTACCTCTGGGA
GGAGACTAGAAGGCACTGACCCGGGAACCTTCTCAGAGAGAGGACCTCCTCTTGAACCCAGGAGCCAAAC
AGTGACCGTGGACTTCTGCCAGGAAATGACTGATAAGTGTACAACTGACGAACAGCCCAGGAAAGATTAT
ACC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC214061 representing NM_021813
Red=Cloning site Green=Tags(s)

MSVDEKPDSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSEYFWQALVGQT
KNDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMHNLEDSCFSFLQTQLLNSEDGL
FVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEP
DVPTDTKESSEKDALTQYPRYKKYQLACTKNVYNASSHSTSGFASTFREDNSSNSLKPGLARGQIKSEPP
SEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITKS
VELSGLPSTSQQHFARSPACPFDKGITQGDLKTDYTPFTGNYGQPHVGQKEVSNFTMGSPLRGPGLEALC
KQEGELDRRSVIFSSSACDQVSTSVHSYSGVSSLDKDLSEPVPKGLWVGAGQSLPSSQAYSHGGLMADHL
PGRMRPNTSCPVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSPCSLPLCEFSSSPCSQGARFLATE
HQEPGLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFSEADSESCPVQDRGQEVKLPFPVDQITDLPRNDF
QMMIKMHKLTSEQLEFIHDVRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMG
ELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL
EPGAAPPGPPWAPSNTSENCTSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDY
T

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021813
ORF Size 2523 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021813.1, NM_021813.2, NM_021813.3, NP_068585
RefSeq Size 9120
RefSeq ORF 2526
Locus ID 60468
Cytogenetics 6q15
Domains BTB, BRLZ
Protein Families Transcription Factors, Druggable Genome
MW 92.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)