CDKN3 (NM_005192) Human Tagged ORF Clone

CAT#: RC213080

CDKN3 (Myc-DDK-tagged)-Human cyclin-dependent kinase inhibitor 3 (CDKN3), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CDKN3 (NM_005192) Human Tagged ORF Clone
Symbol CDKN3
Synonyms CDI1; CIP2; KAP; KAP1
Vector pCMV6-Entry
Sequence Data
>RC213080 representing NM_005192
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCCGCCCAGTTCAATACAAACAAGTGAGTTTGACTCATCAGATGAAGAGCCTATTGAAGATGAAC
AGACTCCAATTCATATATCATGGCTATCTTTGTCACGAGTGAATTGTTCTCAGTTTCTCGGTTTATGTGC
TCTTCCAGGTTGTAAATTTAAAGATGTTAGAAGAAATGTCCAAAAAGATACAGAAGAACTAAAGAGCTGT
GGTATACAAGACATATTTGTTTTCTGCACCAGAGGGGAACTGTCAAAATATAGAGTCCCAAACCTTCTGG
ATCTCTACCAGCAATGTGGAATTATCACCCATCATCATCCAATCGCAGATGGAGGGACTCCTGACATAGC
CAGCTGCTGTGAAATAATGGAAGAGCTTACAACCTGCCTTAAAAATTACCGAAAAACCTTAATACACTGC
TATGGAGGACTTGGGAGATCTTGTCTTGTAGCTGCTTGTCTCCTACTATACCTGTCTGACACAATATCAC
CAGAGCAAGCCATAGACAGCCTGCGAGACCTAAGAGGATCCGGGGCAATACAGACCATCAAGCAATACAA
TTATCTTCATGAGTTTCGGGACAAATTAGCTGCACATCTATCATCAAGAGATTCACAATCAAGATCTGTA
TCAAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213080 representing NM_005192
Red=Cloning site Green=Tags(s)

MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSC
GIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHC
YGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSV
SR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005192
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005192.1, NM_005192.2, NM_005192.3, NP_005183
RefSeq Size 836
RefSeq ORF 639
Locus ID 1033
Cytogenetics 14q22.2
Protein Families Phosphatase, Druggable Genome
MW 23.6 kDa
Gene Summary The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)