HNRPH3 (HNRNPH3) (NM_012207) Human Tagged ORF Clone

CAT#: RC211438

HNRNPH3 (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein H3 (2H9) (HNRNPH3), transcript variant 2H9

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_012207" in other vectors (6)

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-HNRPH3 Antibody
    • 100 ul

USD 485.00

Other products for "HNRPH3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HNRPH3
Synonyms 2H9; HNRPH3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211438 representing NM_012207
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTGGGTTATGAAACATAATGGTCCAAATGACGCTAGTGATGGGACAGTACGACTTCGTGGACTAC
CATTTGGTTGCAGCAAAGAGGAAATAGTTCAGTTCTTTCAAGGGTTGGAAATCGTGCCAAATGGGATAAC
ATTGACGATGGACTACCAGGGGAGAAGCACAGGGGAGGCCTTCGTGCAGTTTGCTTCAAAGGAGATAGCA
GAAAATGCTCTGGGGAAACACAAGGAAAGAATAGGGCACAGGTATATTGAGATCTTCAGAAGTAGCAGGA
GTGAAATCAAAGGATTTTATGATCCACCAAGAAGATTGCTGGGACAGCGACCGGGACCATATGATAGACC
AATAGGAGGAAGAGGGGGTTATTATGGAGCTGGGCGTGGAAGTATGTATGACAGAATGCGACGAGGAGGT
GATGGATATGATGGTGGTTATGGAGGTTTTGATGACTATGGTGGCTATAATAATTACGGCTATGGGAATG
ATGGCTTTGATGACAGAATGAGAGATGGAAGAGGTATGGGAGGACATGGCTATGGTGGAGCTGGTGATGC
AAGTTCAGGTTTTCATGGTGGTCATTTCGTACATATGAGAGGGTTGCCTTTTCGTGCAACTGAAAATGAC
ATTGCTAATTTCTTCTCACCACTAAATCCAATACGAGTTCATATTGATATTGGAGCTGATGGCAGAGCCA
CAGGAGAAGCAGATGTAGAGTTTGTGACACATGAAGATGCAGTAGCTGCCATGTCTAAAGATAAAAATAA
CATGCAACATCGATATATTGAACTCTTCTTGAATTCTACTCCTGGAGGCGGCTCTGGCATGGGAGGTTCT
GGAATGGGAGGCTACGGAAGAGATGGAATGGATAATCAGGGAGGCTATGGATCAGTTGGAAGAATGGGAA
TGGGGAACAATTACAGTGGAGGATATGGTACTCCTGATGGTTTGGGTGGTTATGGCCGTGGTGGTGGAGG
CAGTGGAGGTTACTATGGGCAAGGCGGCATGAGTGGAGGTGGATGGCGTGGGATGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211438 representing NM_012207
Red=Cloning site Green=Tags(s)

MDWVMKHNGPNDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEAFVQFASKEIA
ENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPRRLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRRGG
DGYDGGYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGGHGYGGAGDASSGFHGGHFVHMRGLPFRATEND
IANFFSPLNPIRVHIDIGADGRATGEADVEFVTHEDAVAAMSKDKNNMQHRYIELFLNSTPGGGSGMGGS
GMGGYGRDGMDNQGGYGSVGRMGMGNNYSGGYGTPDGLGGYGRGGGGSGGYYGQGGMSGGGWRGMY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012207
ORF Size 1038 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012207.2
RefSeq Size 2316 bp
RefSeq ORF 1041 bp
Locus ID 3189
UniProt ID P31942
Cytogenetics 10q21.3
Domains RRM
MW 36.7 kDa
Gene Summary This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is localized in nuclear bodies of the nucleus. This protein is involved in the splicing process and it also participates in early heat shock-induced splicing arrest by transiently leaving the hnRNP complexes. Several alternatively spliced transcript variants have been noted for this gene, however, not all are fully characterized. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.