Histone H1.1 (HIST1H1A) (NM_005325) Human Tagged ORF Clone

CAT#: RC211337

HIST1H1A (Myc-DDK-tagged)-Human histone cluster 1, H1a (HIST1H1A)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_005325" in other vectors (4)

Reconstitution Protocol

USD 450.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Histone H1.1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol Histone H1.1
Synonyms H1.1; H1A; H1F1; HIST1; HIST1H1A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211337 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGAAACAGTGCCTCCCGCCCCCGCCGCTTCTGCTGCTCCTGAGAAACCTTTAGCTGGCAAGAAGG
CAAAGAAACCTGCTAAGGCTGCAGCAGCCTCCAAGAAAAAACCCGCTGGCCCTTCCGTGTCAGAGCTGAT
CGTGCAGGCTGCTTCCTCCTCTAAGGAGCGTGGTGGTGTGTCGTTGGCAGCTCTTAAAAAGGCGCTGGCG
GCCGCAGGCTACGACGTGGAGAAGAACAACAGCCGCATTAAGCTGGGCATTAAGAGCCTGGTAAGCAAGG
GAACGTTGGTGCAGACAAAGGGTACCGGAGCCTCGGGTTCCTTCAAGCTCAACAAGAAGGCGTCCTCCGT
GGAAACCAAGCCCGGCGCCTCAAAGGTGGCTACAAAAACTAAGGCAACGGGTGCATCTAAAAAGCTCAAA
AAGGCCACGGGGGCTAGCAAAAAGAGCGTCAAGACTCCGAAAAAGGCTAAAAAGCCTGCGGCAACAAGGA
AATCCTCCAAGAATCCAAAAAAACCCAAAACTGTAAAGCCCAAGAAAGTAGCTAAAAGCCCTGCTAAAGC
TAAGGCTGTAAAACCCAAGGCGGCCAAGGCTAGGGTGACGAAGCCAAAGACTGCCAAACCCAAGAAAGCG
GCACCCAAGAAAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211337 protein sequence
Red=Cloning site Green=Tags(s)

MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALA
AAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLK
KATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKA
APKKK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005325
ORF Size 645 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005325.4
RefSeq Size 781 bp
RefSeq ORF 648 bp
Locus ID 3024
UniProt ID Q02539
Cytogenetics 6p22.2
MW 21.8 kDa
Gene Summary Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Aug 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.