Nucleoside phosphorylase (PNP) (NM_000270) Human Tagged ORF Clone

CAT#: RC210759

PNP (Myc-DDK-tagged)-Human purine nucleoside phosphorylase (PNP)

Product Images

Circular map for RC210759

• 

  Western blot validation of overexpression lysate (Cat# LY424829) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC210759 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified PNP protein (Cat# TP310759). The protein was produced from HEK293T cells transfected with PNP cDNA clone (Cat# RC210759) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Nucleoside phosphorylase
• Synonyms: NP; PRO1837; PUNP
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC210759 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGAACGGATACACCTATGAAGATTATAAGAACACTGCAGAATGGCTTCTGTCTCACACTAAGCACC
  GACCTCAAGTTGCAATAATCTGTGGTTCTGGATTAGGAGGTCTGACTGATAAATTAACTCAGGCCCAGAT
  CTTTGACTACGGTGAAATCCCCAACTTTCCCCGAAGTACAGTGCCAGGTCATGCTGGCCGACTGGTGTTT
  GGGTTCCTGAATGGCAGGGCCTGTGTGATGATGCAGGGCAGGTTCCACATGTATGAAGGGTACCCACTCT
  GGAAGGTGACATTCCCAGTGAGGGTTTTCCACCTTCTGGGTGTGGACACCCTGGTAGTCACCAATGCAGC
  AGGAGGGCTGAACCCCAAGTTTGAGGTTGGAGATATCATGCTGATCCGTGACCATATCAACCTACCTGGT
  TTCAGTGGTCAGAACCCTCTCAGAGGGCCCAATGATGAAAGGTTTGGAGATCGTTTCCCTGCCATGTCTG
  ATGCCTACGACCGGACTATGAGGCAGAGGGCTCTCAGTACCTGGAAACAAATGGGGGAGCAACGTGAGCT
  ACAGGAAGGCACCTATGTGATGGTGGCAGGCCCCAGCTTTGAGACTGTGGCAGAATGTCGTGTGCTGCAG
  AAGCTGGGAGCAGACGCTGTTGGCATGAGTACAGTACCAGAAGTTATCGTTGCACGGCACTGTGGACTTC
  GAGTCTTTGGCTTCTCACTCATCACTAACAAGGTCATCATGGATTATGAAAGCCTGGAGAAGGCCAACCA
  TGAAGAAGTCTTAGCAGCTGGCAAACAAGCTGCACAGAAATTGGAACAGTTTGTCTCCATTCTTATGGCC
  AGCATTCCACTCCCTGACAAAGCCAGT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC210759 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVF
  GFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPG
  FSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQ
  KLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMA
  SIPLPDKAS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_000270
• ORF Size: 867 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_000270.4
• RefSeq Size: 2438 bp
• RefSeq ORF: 870 bp
• Locus ID: 4860
• UniProt ID: P00491
• Cytogenetics: 14q11.2
• Domains: Mtap_PNP
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism
• MW: 32.1 kDa
• Gene Summary: This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq, Jul 2008]