SPCS2 (NM_014752) Human Tagged ORF Clone

CAT#: RC210745

SPCS2 (Myc-DDK-tagged)-Human signal peptidase complex subunit 2 homolog (S. cerevisiae) (SPCS2)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_014752" in other vectors (5)

Reconstitution Protocol

Special Offer: 20% off this product. Use code: "Clone20".

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


SPCS2 mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)
    • 100 ul

USD 447.00

Other products for "SPCS2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SPCS2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210745 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCAGCTGTACAGGGCGGGAGAAGCGGTGGTAGCGGAGGCTGTAGTGGGGCTGGTGGTGCTT
CCAACTGCGGGACAGGAAGTGGCCGTAGCGGCTTGTTGGATAAGTGGAAGATAGATGATAAGCCTGTAAA
AATTGACAAGTGGGATGGATCAGCTGTGAAAAACTCTTTGGATGATTCTGCCAAAAAGGTACTTCTGGAA
AAATACAAATATGTGGAGAATTTTGGTCTAATTGATGGTCGCCTCACCATCTGTACAATCTCCTGTTTCT
TTGCCATAGTGGCTTTGATTTGGGATTATATGCACCCCTTTCCAGAGTCCAAACCCGTTTTGGCTTTGTG
TGTCATATCCTATTTTGTGATGATGGGGATTCTGACCATTTATACCTCATATAAGGAGAAGAGCATCTTT
CTCGTGGCCCACAGGAAAGATCCTACAGGAATGGATCCTGATGATATTTGGCAGCTGTCCTCCAGTCTTA
AAAGGTTTGATGACAAATACACCTTGAAGCTGACCTTCATCAGTGGGAGAACAAAGCAGCAGCGGGAAGC
CGAGTTCACAAAGTCCATTGCTAAGTTTTTTGACCACAGTGGGACACTGGTCATGGATGCATATGAGCCT
GAAATATCCAGGCTCCATGACAGTCTTGCCATAGAAAGAAAAATAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210745 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLE
KYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIF
LVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEP
EISRLHDSLAIERKIK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014752
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014752.3
RefSeq Size 2731 bp
RefSeq ORF 681 bp
Locus ID 9789
UniProt ID Q15005
Cytogenetics 11q13.4
Protein Families Protease, Transmembrane
MW 25 kDa
Gene Summary Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.