RPA4 (NM_013347) Human Tagged ORF Clone

CAT#: RC210239

RPA4 (Myc-DDK-tagged)-Human replication protein A4, 30kDa (RPA4)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_013347" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-RPA4 Antibody
    • 100 ul

USD 539.00

Other products for "RPA4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RPA4
Synonyms HSU24186
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210239 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTAAGAGTGGGTTTGGGAGCTATGGCAGCATTTCTGCTGCTGATGGAGCGAGTGGAGGCAGTGACC
AACTGTGTGAGAGAGATGCAACTCCTGCTATTAAGACCCAAAGACCTAAGGTCCGAATTCAGGACGTTGT
ACCGTGTAATGTGAACCAGCTTCTCAGCTCTACTGTGTTTGACCCTGTGTTCAAGGTTAGGGGAATTATA
GTTTCCCAGGTCTCCATCGTGGGGGTAATCAGAGGGGCAGAGAAGGCTTCAAATCACATTTGTTACAAAA
TTGATGATATGACCGCGAAACCAATCGAGGCCCGACAGTGGTTTGGTAGAGAGAAAGTCAAGCAGGTGAC
TCCATTGTCAGTCGGAGTATATGTCAAAGTGTTTGGTATCCTCAAATGTCCCACGGGAACAAAGAGCCTT
GAGGTATTGAAAATTCATGTCCTAGAGGACATGAACGAGTTCACCGTGCATATTCTGGAAACGGTCAATG
CACACATGATGCTGGATAAAGCCCGTCGTGATACCACTGTAGAAAGTGTGCCTGTGTCTCCATCAGAAGT
GAATGATGCTGGGGATAACGATGAGAGTCACCGCAATTTCATCCAGGACGAAGTGCTGCGTTTGATTCAT
GAGTGTCCTCATCAGGAAGGGAAGAGCATCCATGAGCTCCGGGCTCAGCTCTGCGACCTTAGCGTCAAGG
CCATCAAGGAAGCGATTGATTATCTGACCGTTGAGGGCCACATCTATCCCACTGTGGATCGGGAGCATTT
TAAGTCTGCTGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210239 protein sequence
Red=Cloning site Green=Tags(s)

MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGII
VSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSL
EVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIH
ECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013347
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013347.4, NP_037479.1
RefSeq Size 1560 bp
RefSeq ORF 786 bp
Locus ID 29935
UniProt ID Q13156
Cytogenetics Xq21.33
Protein Families Druggable Genome
Protein Pathways DNA replication, Homologous recombination, Mismatch repair, Nucleotide excision repair
MW 28.9 kDa
Gene Summary This gene encodes a single-stranded DNA-binding protein that is the 30-kDa subunit of the replication protein A complex. Replication protein A is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. The encoded protein localizes to DNA repair foci and may be involved in the cellular DNA damage response. This protein may also play a role in inhibiting viral replication.[provided by RefSeq, Apr 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.