CA8 (NM_004056) Human Tagged ORF Clone

CAT#: RC210228

Reviews ()
Write a review

CA8 (Myc-DDK-tagged)-Human carbonic anhydrase VIII (CA8)



  "NM_004056" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CA8
Synonyms CA-RP; CA-VIII; CALS; CAMRQ3; CARP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210228 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACCTGAGCTTCATCGAAGATACCGTCGCCTTCCCCGAGAAGGAAGAGGATGAGGAGGAAGAAG
AGGAGGGTGTGGAGTGGGGCTACGAGGAAGGTGTTGAGTGGGGTCTGGTGTTTCCTGATGCTAATGGGGA
ATACCAGTCTCCTATTAACCTAAACTCAAGAGAGGCTAGGTATGACCCCTCGCTGTTGGATGTCCGCCTC
TCCCCAAATTATGTGGTGTGCCGAGACTGTGAAGTCACCAATGATGGACATACCATTCAGGTTATCCTGA
AGTCAAAATCAGTTCTTTCGGGAGGACCATTGCCTCAAGGGCATGAATTTGAACTGTACGAAGTGAGATT
TCACTGGGGAAGAGAAAACCAGCGTGGTTCTGAGCACACGGTTAATTTCAAAGCTTTTCCCATGGAGCTC
CATCTGATCCACTGGAACTCCACTCTGTTTGGCAGCATTGATGAGGCTGTGGGGAAGCCGCACGGAATCG
CCATCATTGCTCTGTTTGTTCAGATAGGAAAGGAACATGTTGGCTTGAAGGCTGTGACTGAAATCCTCCA
AGATATTCAGTATAAGGGGAAGTCCAAAACAATACCTTGCTTTAATCCTAACACTTTATTACCAGACCCT
CTGCTGCGGGATTACTGGGTGTATGAAGGCTCTCTCACCATCCCACCTTGCAGTGAAGGTGTCACCTGGA
TATTATTCCGATACCCTTTAACTATATCCCAGCTACAGATAGAAGAATTTCGAAGGCTGAGGACACATGT
TAAGGGGGCAGAACTTGTGGAAGGCTGTGATGGGATTTTGGGAGACAACTTTCGGCCCACTCAGCCTCTT
AGTGACAGAGTCATTAGAGCTGCATTTCAG


ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA
TTACAAGGATGACGACGATAAG
GTTTAA
>RC210228 protein sequence
Red=Cloning site Green=Tags(s)

MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRL
SPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMEL
HLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDP
LLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPL
SDRVIRAAFQ

TRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-NotI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004056
ORF Size 870 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004056.6
RefSeq Size 2278 bp
RefSeq ORF 873 bp
Locus ID 767
UniProt ID P35219
Cytogenetics 8q12.1
Domains carb_anhydrase
Protein Families Druggable Genome
Protein Pathways Nitrogen metabolism
MW 33 kDa
Gene Summary The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. Mutations in this gene are associated with cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3). Polymorphisms in this gene are associated with osteoporosis, and overexpression of this gene in osteosarcoma cells suggests an oncogenic role. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-CA8 Antibody
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.