Cannabinoid Receptor II(CNR2) (NM_001841) Human Tagged ORF Clone

CAT#: RC210224

CNR2 (Myc-DDK-tagged)-Human cannabinoid receptor 2 (macrophage) (CNR2)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cannabinoid Receptor II(CNR2) (NM_001841) Human Tagged ORF Clone
Symbol CNR2
Synonyms CB-2; CB2; CX5
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC210224 representing NM_001841
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAATGCTGGGTGACAGAGATAGCCAATGGCTCCAAGGATGGCTTGGATTCCAACCCTATGAAGG
ATTACATGATCCTGAGTGGTCCCCAGAAGACAGCTGTTGCTGTGTTGTGCACTCTTCTGGGCCTGCTAAG
TGCCCTGGAGAACGTGGCTGTGCTCTATCTGATCCTGTCCTCCCACCGGCTCCGCCGGAAGCCCTCATAC
CTGTTCATTGGCAGCTTGGCTGGGGCTGACTTCCTGGCCAGTGTGGTCTTTGCATGCAGCTTTGTGAATT
TCCATGTTTTCCATGGTGTGGATTCCAAGGCTGTCTTCCTGCTGAAGATTGGCAGCGTGACTATGACCTT
CACAGCCTCTGTGGGTAGCCTCCTGCTGACCGCCATTGACCGATACCTCTGCCTGCGCTATCCACCTTCC
TACAAAGCTCTGCTCACCCGTGGAAGGGCACTGGTGACCCTGGGTATCATGTGGGTCCTCTCAGCACTAG
TCTCCTACCTGCCCCTCATGGGATGGACTTGCTGTCCCAGGCCCTGCTCTGAGCTTTTCCCACTGATCCC
CAATGACTACCTGCTGAGCTGGCTCCTGTTCATCGCCTTCCTCTTTTCCGGAATCATCTACACCTATGGG
CATGTTCTCTGGAAGGCCCATCAGCATGTAGCCAGCTTGTCTGGCCACCAGGACAGGCAGGTGCCAGGAA
TGGCCCGAATGAGGCTGGATGTGAGGTTGGCCAAGACCCTAGGGCTAGTGCTGGCTGTGCTCCTCATCTG
TTGGTTCCCAGTGCTGGCCCTCATGGCCCACAGCCTGGCCACTACGCTCAGTGACCAGGTCAAGAAGGCC
TTTGCCTTCTGCTCCATGCTGTGCCTCATCAACTCCATGGTCAACCCTGTCATCTATGCTCTACGGAGTG
GAGAGATCCGCTCCTCTGCCCATCACTGCCTGGCTCACTGGAAGAAGTGTGTGAGGGGCCTTGGGTCAGA
GGCAAAAGAAGAAGCCCCAAGATCCTCAGTCACGGAGACAGAGGCTGATGGGAAAATCACTCCGTGGCCA
GATTCCAGAGATCTAGACCTCTCTGATTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210224 representing NM_001841
Red=Cloning site Green=Tags(s)

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHRLRRKPSY
LFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPS
YKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYG
HVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKA
FAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWP
DSRDLDLSDC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001841
ORF Size 1080 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001841.1, NM_001841.2, NP_001832
RefSeq Size 1776
RefSeq ORF 1083
Locus ID 1269
Cytogenetics 1p36.11
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 39.5 kDa
Gene Summary The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations