CHRNB3 (NM_000749) Human Tagged ORF Clone

CAT#: RC210221

CHRNB3 (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, beta 3 (CHRNB3)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CHRNB3 (NM_000749) Human Tagged ORF Clone
Symbol CHRNB3
Synonyms acetylcholine receptor, neuronal nicotinic, beta-3 subunit; cholinergic receptor, nicotinic, beta polypeptide 3; cholinergic receptor, nicotinic, beta 3
Vector pCMV6-Entry
Sequence Data
>RC210221 representing NM_000749
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCCCAGATTTTATGCTGGTTCTCATCGTCCTTGGCATCCCTTCCTCAGCCACCACAGGTTTCAACT
CAATCGCCGAAAATGAAGATGCCCTCCTCAGACATTTGTTCCAAGGTTATCAGAAATGGGTCCGCCCTGT
ATTACATTCTAATGACACCATAAAAGTATATTTTGGATTGAAAATATCCCAGCTTGTAGATGTGGATGAA
AAGAATCAGCTGATGACAACCAATGTGTGGCTCAAACAGGAATGGACAGACCACAAGTTACGCTGGAATC
CTGATGATTATGGTGGGATCCATTCCATTAAAGTTCCATCAGAATCTCTGTGGCTTCCTGACATAGTTCT
CTTTGAAAATGCTGACGGCCGCTTCGAAGGCTCCCTGATGACCAAGGTCATCGTGAAATCAAACGGAACT
GTTGTCTGGACCCCTCCCGCCAGCTACAAAAGCTCCTGCACCATGGACGTCACGTTTTTCCCGTTCGACC
GACAGAACTGCTCCATGAAGTTTGGATCCTGGACTTATGATGGCACCATGGTTGACCTCATTTTGATCAA
TGAAAATGTCGACAGAAAAGACTTCTTCGATAACGGAGAATGGGAAATACTGAATGCAAAGGGGATGAAG
GGGAACAGAAGGGACGGCGTGTACTCCTATCCCTTTATCACGTATTCCTTCGTCCTGAGACGCCTGCCTT
TATTCTATACCCTCTTTCTCATCATCCCCTGCCTGGGGCTGTCTTTCCTAACAGTTCTTGTGTTCTATTT
ACCTTCGGATGAAGGAGAAAAACTTTCATTATCCACATCGGTCTTGGTTTCTCTGACAGTTTTCCTTTTA
GTGATTGAAGAAATCATCCCATCGTCTTCCAAAGTCATTCCTCTCATTGGAGAGTACCTGCTGTTCATCA
TGATTTTTGTGACCCTGTCCATCATTGTTACCGTGTTTGTCATTAACGTTCACCACAGATCTTCTTCCAC
GTACCACCCCATGGCCCCCTGGGTTAAGAGGCTCTTTCTGCAGAAACTTCCAAAATTACTTTGCATGAAA
GATCATGTGGATCGCTACTCATCCCCAGAGAAAGAGGAGAGTCAACCAGTAGTGAAAGGCAAAGTCCTCG
AAAAAAAGAAACAGAAACAGCTTAGTGATGGAGAAAAAGTTCTAGTTGCTTTTTTGGAAAAAGCTGCTGA
TTCCATTAGATACATTTCCAGACATGTGAAGAAAGAACATTTTATCAGCCAGGTAGTACAAGACTGGAAA
TTTGTAGCTCAAGTTCTTGACCGAATCTTCCTGTGGCTCTTTCTGATAGTGTCAGTAACAGGCTCGGTTC
TGATTTTTACCCCTGCTTTGAAGATGTGGCTACATAGTTACCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210221 representing NM_000749
Red=Cloning site Green=Tags(s)

MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDE
KNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGT
VVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMK
GNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLL
VIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMK
DHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000749
ORF Size 1374 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000749.1, NM_000749.2, NM_000749.3, NM_000749.4, NP_000740
RefSeq Size 1953
RefSeq ORF 1377
Locus ID 1142
Cytogenetics 8p11.21
Protein Families Ion Channels: Cys-loop Receptors, Transmembrane, Druggable Genome
MW 52.5 kDa
Gene Summary After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)