POLD4 (NM_021173) Human Tagged ORF Clone

CAT#: RC209992

POLD4 (Myc-DDK-tagged)-Human polymerase (DNA-directed), delta 4 (POLD4)

Product Images

Circular map for RC209992

• 

  Western blot validation of overexpression lysate (Cat# LY412048) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC209992 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified POLD4 protein (Cat# TP309992). The protein was produced from HEK293T cells transfected with POLD4 cDNA clone (Cat# RC209992) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: POLD4
• Synonyms: p12; POLDS
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC209992 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGCCGGAAGCGGCTCATCACTGATTCCTACCCGGTTGTGAAGAGGAGGGAGGGGCCCGCTGGGCACA
  GCAAGGGGGAGCTGGCACCCGAGCTAGGGGAGGAGCCCCAGCCCCGCGACGAGGAGGAAGCGGAGCTGGA
  GCTGCTGAGGCAGTTTGACCTGGCCTGGCAGTACGGGCCCTGCACCGGGATCACACGGCTGCAGCGCTGG
  TGTCGGGCCAAGCATATGGGCTTGGAGCCTCCCCCAGAGGTGTGGCAGGTGCTGAAGACCCACCCCGGAG
  ACCCCCGCTTCCAGTGCAGTCTCTGGCATCTCTATCCCCTA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC209992 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRW
  CRAKHMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_021173
• ORF Size: 321 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_021173.2, NP_066996.2
• RefSeq Size: 1751 bp
• RefSeq ORF: 324 bp
• Locus ID: 57804
• UniProt ID: Q9HCU8
• Cytogenetics: 11q13.2
• Domains: DNA_pol_delta_4
• Protein Pathways: Base excision repair, DNA replication, Homologous recombination, Metabolic pathways, Mismatch repair, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism
• MW: 12.4 kDa
• Gene Summary: This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]