MTX2 (NM_006554) Human Tagged ORF Clone

CAT#: RC209825

MTX2 (Myc-DDK-tagged)-Human metaxin 2 (MTX2), nuclear gene encoding mitochondrial protein, transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_006554" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


MTX2 mouse monoclonal antibody,clone OTI2E9
    • 100 ul

USD 447.00

Other products for "MTX2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MTX2
Synonyms MDPS; metaxin-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209825 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTAGTGGCGGAAGCCTTCGTCTCCCAGATTGCAGCTGCAGAACCTTGGCCTGAAAATGCTACAT
TATATCAGCAATTGAAAGGGGAGCAAATTTTACTTTCTGACAATGCAGCTTCTCTTGCAGTGCAGGCCTT
TTTGCAAATGTGTAACTTGCCTATCAAAGTAGTTTGTAGGGCAAATGCAGAATATATGTCTCCATCTGGT
AAAGTACCTTTTATTCATGTGGGAAATCAAGTAGTATCAGAACTTGGTCCAATAGTCCAATTTGTTAAAG
CCAAGGGCCATTCTCTTAGTGATGGGCTGGAGGAAGTCCAAAAAGCAGAAATGAAAGCTTACATGGAATT
AGTCAACAATATGCTGTTGACTGCAGAGCTGTATCTTCAGTGGTGTGATGAAGCTACAGTAGGGGAGATC
ACTCATGCTAGGTATGGATCTCCTTACCCTTGGCCTCTGAATCATATTTTGGCCTATCAAAAACAGTGGG
AAGTCAAACGTAAGATGAAAGCTATTGGATGGGGAAAGAAGACTCTGGACCAGGTCTTAGAGGATGTAGA
CCAGTGCTGTCAAGCTCTCTCTCAAAGACTGGGAACACAACCGTATTTCTTCAATAAGCAGCCTACTGAA
CTTGACGCACTGGTATTTGGCCATCTATACACCATTCTTACCACACAATTGACAAATGATGAACTTTCTG
AGAAGGTGAAAAACTATAGCAACCTCCTTGCTTTCTGTAGGAGAATTGAACAGCACTATTTTGAAGATCG
TGGTAAAGGCAGGCTGTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209825 protein sequence
Red=Cloning site Green=Tags(s)

MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSG
KVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLEEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEI
THARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTE
LDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQHYFEDRGKGRLS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006554
ORF Size 789 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006554.5
RefSeq Size 1399 bp
RefSeq ORF 792 bp
Locus ID 10651
UniProt ID O75431
Cytogenetics 2q31.1
MW 29.8 kDa
Gene Summary The protein encoded by this gene is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane, and that it is involved in the import of proteins into the mitochondrion. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Jun 2009]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.