Y14 (RBM8A) (NM_005105) Human Tagged ORF Clone

CAT#: RC209770

RBM8A (Myc-DDK-tagged)-Human RNA binding motif protein 8A (RBM8A)

Product Images

Circular map for RC209770

• 

  Western blot validation of overexpression lysate (Cat# LY417520) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC209770 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified RBM8A protein (Cat# TP309770). The protein was produced from HEK293T cells transfected with RBM8A cDNA clone (Cat# RC209770) using MegaTran 2.0 (Cat# TT210002).

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY RBM8A (Cat# RC209770, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RBM8A (Cat# TA812498)(1:500). Positive lysates LY417520 (100ug) and LC417520 (20ug) can be purchased separately from OriGene.

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Y14
• Synonyms: BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC209770 representing NM_005105
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGACGTGCTAGATCTTCACGAGGCTGGGGGCGAAGATTTCGCCATGGATGAGGATGGGGACGAGA
  GCATTCACAAACTGAAAGAAAAAGCGAAGAAACGGAAGGGTCGCGGCTTTGGCTCCGAAGAGGGGTCCCG
  AGCGCGGATGCGTGAGGATTATGACAGCGTGGAGCAGGATGGCGATGAACCCGGACCACAACGCTCTGTT
  GAAGGCTGGATTCTCTTTGTAACTGGAGTCCATGAGGAAGCCACCGAAGAAGACATACACGACAAATTCG
  CAGAATATGGGGAAATTAAAAACATTCATCTCAACCTCGACAGGCGAACAGGATATCTGAAGGGGTATAC
  TCTAGTTGAATATGAAACATACAAGGAAGCCCAGGCTGCTATGGAGGGACTCAATGGCCAGGATTTGATG
  GGACAGCCCATCAGCGTTGACTGGTGTTTTGTTCGGGGTCCACCAAAAGGCAAGAGGAGAGGTGGCCGAA
  GACGCAGCAGAAGTCCAGACCGGAGACGTCGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC209770 representing NM_005105
  Red=Cloning site Green=Tags(s)
  
  MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV
  EGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM
  GQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005105
• ORF Size: 522 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_005105.5
• RefSeq Size: 2787 bp
• RefSeq ORF: 525 bp
• Locus ID: 9939
• UniProt ID: Q9Y5S9
• Cytogenetics: 1q21.1
• Domains: RRM
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome
• MW: 19.7 kDa
• Gene Summary: This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. There are two alternate translation start codons with this gene, which result in two forms of the protein. An allele mutation and a low-frequency noncoding single-nucleotide polymorphism (SNP) in this gene cause thrombocytopenia-absent radius (TAR) syndrome. [provided by RefSeq, Jul 2013]